Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 509321..509868 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag VCBK1071_RS17065 Protein ID WP_084980737.1
Coordinates 509566..509868 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag VCBK1071_RS17060 Protein ID WP_101411835.1
Coordinates 509321..509578 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS17020 505472..505690 + 219 WP_162812189.1 DUF3709 domain-containing protein -
VCBK1071_RS17025 505965..506462 - 498 WP_084981378.1 GNAT family N-acetyltransferase -
VCBK1071_RS17030 506459..506731 - 273 WP_000246254.1 DUF1778 domain-containing protein -
VCBK1071_RS17035 506968..507543 + 576 WP_000199096.1 class I SAM-dependent methyltransferase -
VCBK1071_RS17040 507540..507650 + 111 WP_080368444.1 DUF3265 domain-containing protein -
VCBK1071_RS17045 507724..507954 - 231 WP_084980734.1 secretion protein -
VCBK1071_RS17050 508092..508199 + 108 WP_084980735.1 acetyltransferase -
VCBK1071_RS17055 508632..509129 + 498 WP_000259910.1 GNAT family N-acetyltransferase -
VCBK1071_RS17060 509321..509578 + 258 WP_101411835.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
VCBK1071_RS17065 509566..509868 + 303 WP_084980737.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
VCBK1071_RS17070 510357..510467 + 111 WP_084980740.1 DUF3265 domain-containing protein -
VCBK1071_RS17080 510651..510804 + 154 Protein_564 DUF645 family protein -
VCBK1071_RS17090 511008..512054 + 1047 WP_142581009.1 hypothetical protein -
VCBK1071_RS20665 512111..512203 + 93 WP_192858804.1 acetyltransferase -
VCBK1071_RS17095 512191..513117 + 927 WP_084980739.1 PD-(D/E)XK nuclease superfamily protein -
VCBK1071_RS17105 513235..513552 - 318 WP_000077272.1 CcdB family protein -
VCBK1071_RS17110 513552..513797 - 246 WP_001260801.1 type II toxin-antitoxin system CcdA family antitoxin -
VCBK1071_RS17115 514051..514764 + 714 WP_000123659.1 Fic family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- flank IS/Tn - - 504021..505061 1040
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11719.63 Da        Isoelectric Point: 5.1972

>T293626 WP_084980737.1 NZ_LT897798:509566-509868 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVIRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9646.17 Da        Isoelectric Point: 8.5563

>AT293626 WP_101411835.1 NZ_LT897798:509321-509578 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLINVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References