Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 505965..506731 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag VCBK1071_RS17025 Protein ID WP_084981378.1
Coordinates 505965..506462 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag VCBK1071_RS17030 Protein ID WP_000246254.1
Coordinates 506459..506731 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16985 501301..501789 + 489 WP_000424240.1 hypothetical protein -
VCBK1071_RS20490 501945..502604 + 660 WP_145958157.1 hypothetical protein -
VCBK1071_RS16995 502742..503278 + 537 WP_095464264.1 ATP-binding protein -
VCBK1071_RS17000 503455..503721 + 267 WP_101411829.1 BrnT family toxin -
VCBK1071_RS17005 503708..503953 + 246 WP_101411831.1 CopG family transcriptional regulator -
VCBK1071_RS17010 504021..505061 - 1041 WP_101411269.1 IS481 family transposase -
VCBK1071_RS17020 505472..505690 + 219 WP_162812189.1 DUF3709 domain-containing protein -
VCBK1071_RS17025 505965..506462 - 498 WP_084981378.1 GNAT family N-acetyltransferase Toxin
VCBK1071_RS17030 506459..506731 - 273 WP_000246254.1 DUF1778 domain-containing protein Antitoxin
VCBK1071_RS17035 506968..507543 + 576 WP_000199096.1 class I SAM-dependent methyltransferase -
VCBK1071_RS17040 507540..507650 + 111 WP_080368444.1 DUF3265 domain-containing protein -
VCBK1071_RS17045 507724..507954 - 231 WP_084980734.1 secretion protein -
VCBK1071_RS17050 508092..508199 + 108 WP_084980735.1 acetyltransferase -
VCBK1071_RS17055 508632..509129 + 498 WP_000259910.1 GNAT family N-acetyltransferase -
VCBK1071_RS17060 509321..509578 + 258 WP_101411835.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
VCBK1071_RS17065 509566..509868 + 303 WP_084980737.1 type II toxin-antitoxin system RelE/ParE family toxin -
VCBK1071_RS17070 510357..510467 + 111 WP_084980740.1 DUF3265 domain-containing protein -
VCBK1071_RS17080 510651..510804 + 154 Protein_564 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- flank IS/Tn - - 504021..505061 1040
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(2-89)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18627.29 Da        Isoelectric Point: 8.0186

>T293625 WP_084981378.1 NZ_LT897798:c506462-505965 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNNSTYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDDAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9685.19 Da        Isoelectric Point: 6.2988

>AT293625 WP_000246254.1 NZ_LT897798:c506731-506459 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLTKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVANAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References