Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 505965..506731 | Replicon | chromosome |
| Accession | NZ_LT897798 | ||
| Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | VCBK1071_RS17025 | Protein ID | WP_084981378.1 |
| Coordinates | 505965..506462 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | VCBK1071_RS17030 | Protein ID | WP_000246254.1 |
| Coordinates | 506459..506731 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VCBK1071_RS16985 | 501301..501789 | + | 489 | WP_000424240.1 | hypothetical protein | - |
| VCBK1071_RS20490 | 501945..502604 | + | 660 | WP_145958157.1 | hypothetical protein | - |
| VCBK1071_RS16995 | 502742..503278 | + | 537 | WP_095464264.1 | ATP-binding protein | - |
| VCBK1071_RS17000 | 503455..503721 | + | 267 | WP_101411829.1 | BrnT family toxin | - |
| VCBK1071_RS17005 | 503708..503953 | + | 246 | WP_101411831.1 | CopG family transcriptional regulator | - |
| VCBK1071_RS17010 | 504021..505061 | - | 1041 | WP_101411269.1 | IS481 family transposase | - |
| VCBK1071_RS17020 | 505472..505690 | + | 219 | WP_162812189.1 | DUF3709 domain-containing protein | - |
| VCBK1071_RS17025 | 505965..506462 | - | 498 | WP_084981378.1 | GNAT family N-acetyltransferase | Toxin |
| VCBK1071_RS17030 | 506459..506731 | - | 273 | WP_000246254.1 | DUF1778 domain-containing protein | Antitoxin |
| VCBK1071_RS17035 | 506968..507543 | + | 576 | WP_000199096.1 | class I SAM-dependent methyltransferase | - |
| VCBK1071_RS17040 | 507540..507650 | + | 111 | WP_080368444.1 | DUF3265 domain-containing protein | - |
| VCBK1071_RS17045 | 507724..507954 | - | 231 | WP_084980734.1 | secretion protein | - |
| VCBK1071_RS17050 | 508092..508199 | + | 108 | WP_084980735.1 | acetyltransferase | - |
| VCBK1071_RS17055 | 508632..509129 | + | 498 | WP_000259910.1 | GNAT family N-acetyltransferase | - |
| VCBK1071_RS17060 | 509321..509578 | + | 258 | WP_101411835.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| VCBK1071_RS17065 | 509566..509868 | + | 303 | WP_084980737.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| VCBK1071_RS17070 | 510357..510467 | + | 111 | WP_084980740.1 | DUF3265 domain-containing protein | - |
| VCBK1071_RS17080 | 510651..510804 | + | 154 | Protein_564 | DUF645 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
| - | flank | IS/Tn | - | - | 504021..505061 | 1040 | |
| - | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18627.29 Da Isoelectric Point: 8.0186
>T293625 WP_084981378.1 NZ_LT897798:c506462-505965 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNNSTYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDDAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNNSTYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDDAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|