Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 503455..503953 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag VCBK1071_RS17000 Protein ID WP_101411829.1
Coordinates 503455..503721 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag VCBK1071_RS17005 Protein ID WP_101411831.1
Coordinates 503708..503953 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16935 498545..498640 + 96 WP_101411823.1 acetyltransferase -
VCBK1071_RS16940 498641..499081 + 441 WP_001966102.1 DUF1311 domain-containing protein -
VCBK1071_RS20615 499436..499531 + 96 WP_001907607.1 DUF645 family protein -
VCBK1071_RS16955 499884..500065 + 182 Protein_544 DUF645 family protein -
VCBK1071_RS16965 500429..500599 + 171 WP_001928536.1 DUF645 family protein -
VCBK1071_RS16975 500805..501083 + 279 WP_001012254.1 hypothetical protein -
VCBK1071_RS16985 501301..501789 + 489 WP_000424240.1 hypothetical protein -
VCBK1071_RS20490 501945..502604 + 660 WP_145958157.1 hypothetical protein -
VCBK1071_RS16995 502742..503278 + 537 WP_095464264.1 ATP-binding protein -
VCBK1071_RS17000 503455..503721 + 267 WP_101411829.1 BrnT family toxin Toxin
VCBK1071_RS17005 503708..503953 + 246 WP_101411831.1 CopG family transcriptional regulator Antitoxin
VCBK1071_RS17010 504021..505061 - 1041 WP_101411269.1 IS481 family transposase -
VCBK1071_RS17020 505472..505690 + 219 WP_162812189.1 DUF3709 domain-containing protein -
VCBK1071_RS17025 505965..506462 - 498 WP_084981378.1 GNAT family N-acetyltransferase -
VCBK1071_RS17030 506459..506731 - 273 WP_000246254.1 DUF1778 domain-containing protein -
VCBK1071_RS17035 506968..507543 + 576 WP_000199096.1 class I SAM-dependent methyltransferase -
VCBK1071_RS17040 507540..507650 + 111 WP_080368444.1 DUF3265 domain-containing protein -
VCBK1071_RS17045 507724..507954 - 231 WP_084980734.1 secretion protein -
VCBK1071_RS17050 508092..508199 + 108 WP_084980735.1 acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- flank IS/Tn - - 504021..505061 1040
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10078.31 Da        Isoelectric Point: 7.3171

>T293624 WP_101411829.1 NZ_LT897798:503455-503721 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGVWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9435.74 Da        Isoelectric Point: 6.0736

>AT293624 WP_101411831.1 NZ_LT897798:503708-503953 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References