Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 497289..497867 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag VCBK1071_RS16915 Protein ID WP_001180240.1
Coordinates 497289..497606 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag VCBK1071_RS16920 Protein ID WP_000557292.1
Coordinates 497625..497867 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16880 492988..493566 + 579 WP_162796677.1 DJ-1/PfpI family protein -
VCBK1071_RS16885 493704..494171 + 468 WP_101411817.1 hypothetical protein -
VCBK1071_RS16890 494332..494652 + 321 WP_101411819.1 hypothetical protein -
VCBK1071_RS16895 494881..495531 + 651 WP_000744350.1 hypothetical protein -
VCBK1071_RS16900 495826..496044 + 219 WP_162812189.1 DUF3709 domain-containing protein -
VCBK1071_RS16905 496369..496638 + 270 WP_001114075.1 DUF4160 domain-containing protein -
VCBK1071_RS16910 496632..497153 + 522 WP_000921691.1 DUF2442 domain-containing protein -
VCBK1071_RS16915 497289..497606 - 318 WP_001180240.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
VCBK1071_RS16920 497625..497867 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
VCBK1071_RS16925 498102..498488 + 387 WP_101411821.1 tautomerase family protein -
VCBK1071_RS16935 498545..498640 + 96 WP_101411823.1 acetyltransferase -
VCBK1071_RS16940 498641..499081 + 441 WP_001966102.1 DUF1311 domain-containing protein -
VCBK1071_RS20615 499436..499531 + 96 WP_001907607.1 DUF645 family protein -
VCBK1071_RS16955 499884..500065 + 182 Protein_544 DUF645 family protein -
VCBK1071_RS16965 500429..500599 + 171 WP_001928536.1 DUF645 family protein -
VCBK1071_RS16975 500805..501083 + 279 WP_001012254.1 hypothetical protein -
VCBK1071_RS16985 501301..501789 + 489 WP_000424240.1 hypothetical protein -
VCBK1071_RS20490 501945..502604 + 660 WP_145958157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12115.92 Da        Isoelectric Point: 9.3000

>T293623 WP_001180240.1 NZ_LT897798:c497606-497289 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
CILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT293623 WP_000557292.1 NZ_LT897798:c497867-497625 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References