Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 497289..497867 | Replicon | chromosome |
| Accession | NZ_LT897798 | ||
| Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | VCBK1071_RS16915 | Protein ID | WP_001180240.1 |
| Coordinates | 497289..497606 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q7DCR7 |
| Locus tag | VCBK1071_RS16920 | Protein ID | WP_000557292.1 |
| Coordinates | 497625..497867 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VCBK1071_RS16880 | 492988..493566 | + | 579 | WP_162796677.1 | DJ-1/PfpI family protein | - |
| VCBK1071_RS16885 | 493704..494171 | + | 468 | WP_101411817.1 | hypothetical protein | - |
| VCBK1071_RS16890 | 494332..494652 | + | 321 | WP_101411819.1 | hypothetical protein | - |
| VCBK1071_RS16895 | 494881..495531 | + | 651 | WP_000744350.1 | hypothetical protein | - |
| VCBK1071_RS16900 | 495826..496044 | + | 219 | WP_162812189.1 | DUF3709 domain-containing protein | - |
| VCBK1071_RS16905 | 496369..496638 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
| VCBK1071_RS16910 | 496632..497153 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
| VCBK1071_RS16915 | 497289..497606 | - | 318 | WP_001180240.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| VCBK1071_RS16920 | 497625..497867 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| VCBK1071_RS16925 | 498102..498488 | + | 387 | WP_101411821.1 | tautomerase family protein | - |
| VCBK1071_RS16935 | 498545..498640 | + | 96 | WP_101411823.1 | acetyltransferase | - |
| VCBK1071_RS16940 | 498641..499081 | + | 441 | WP_001966102.1 | DUF1311 domain-containing protein | - |
| VCBK1071_RS20615 | 499436..499531 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
| VCBK1071_RS16955 | 499884..500065 | + | 182 | Protein_544 | DUF645 family protein | - |
| VCBK1071_RS16965 | 500429..500599 | + | 171 | WP_001928536.1 | DUF645 family protein | - |
| VCBK1071_RS16975 | 500805..501083 | + | 279 | WP_001012254.1 | hypothetical protein | - |
| VCBK1071_RS16985 | 501301..501789 | + | 489 | WP_000424240.1 | hypothetical protein | - |
| VCBK1071_RS20490 | 501945..502604 | + | 660 | WP_145958157.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
| - | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12115.92 Da Isoelectric Point: 9.3000
>T293623 WP_001180240.1 NZ_LT897798:c497606-497289 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
CILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
CILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|