Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DhiAT/- |
Location | 496369..497153 | Replicon | chromosome |
Accession | NZ_LT897798 | ||
Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | VCBK1071_RS16905 | Protein ID | WP_001114075.1 |
Coordinates | 496369..496638 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | Q9KM84 |
Locus tag | VCBK1071_RS16910 | Protein ID | WP_000921691.1 |
Coordinates | 496632..497153 (+) | Length | 174 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCBK1071_RS16875 | 491928..492845 | + | 918 | WP_101411813.1 | alpha/beta hydrolase | - |
VCBK1071_RS16880 | 492988..493566 | + | 579 | WP_162796677.1 | DJ-1/PfpI family protein | - |
VCBK1071_RS16885 | 493704..494171 | + | 468 | WP_101411817.1 | hypothetical protein | - |
VCBK1071_RS16890 | 494332..494652 | + | 321 | WP_101411819.1 | hypothetical protein | - |
VCBK1071_RS16895 | 494881..495531 | + | 651 | WP_000744350.1 | hypothetical protein | - |
VCBK1071_RS16900 | 495826..496044 | + | 219 | WP_162812189.1 | DUF3709 domain-containing protein | - |
VCBK1071_RS16905 | 496369..496638 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
VCBK1071_RS16910 | 496632..497153 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
VCBK1071_RS16915 | 497289..497606 | - | 318 | WP_001180240.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VCBK1071_RS16920 | 497625..497867 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
VCBK1071_RS16925 | 498102..498488 | + | 387 | WP_101411821.1 | tautomerase family protein | - |
VCBK1071_RS16935 | 498545..498640 | + | 96 | WP_101411823.1 | acetyltransferase | - |
VCBK1071_RS16940 | 498641..499081 | + | 441 | WP_001966102.1 | DUF1311 domain-containing protein | - |
VCBK1071_RS20615 | 499436..499531 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
VCBK1071_RS16955 | 499884..500065 | + | 182 | Protein_544 | DUF645 family protein | - |
VCBK1071_RS16965 | 500429..500599 | + | 171 | WP_001928536.1 | DUF645 family protein | - |
VCBK1071_RS16975 | 500805..501083 | + | 279 | WP_001012254.1 | hypothetical protein | - |
VCBK1071_RS16985 | 501301..501789 | + | 489 | WP_000424240.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
- | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T293622 WP_001114075.1 NZ_LT897798:496369-496638 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT293622 WP_000921691.1 NZ_LT897798:496632-497153 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM84 |