293621

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 483156..483696 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name relE Uniprot ID A0A151JGK8
Locus tag VCBK1071_RS16770 Protein ID WP_000277238.1
Coordinates 483156..483425 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag VCBK1071_RS16775 Protein ID WP_101411799.1
Coordinates 483418..483696 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16720 478306..478716 - 411 WP_101411797.1 type II toxin-antitoxin system PemK/MazF family toxin -
VCBK1071_RS16725 478780..478881 + 102 WP_101412278.1 DUF3265 domain-containing protein -
VCBK1071_RS16730 479068..479232 + 165 WP_001902694.1 DUF645 family protein -
VCBK1071_RS16740 479521..479739 + 219 WP_101411788.1 hypothetical protein -
VCBK1071_RS16745 480232..480342 + 111 WP_080284294.1 DUF3265 domain-containing protein -
VCBK1071_RS16755 481436..482035 - 600 WP_000256443.1 chorismate mutase -
VCBK1071_RS16760 482144..482458 + 315 WP_001893674.1 Dabb family protein -
VCBK1071_RS16765 482594..483019 + 426 WP_000693748.1 hypothetical protein -
VCBK1071_RS16770 483156..483425 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin Toxin
VCBK1071_RS16775 483418..483696 - 279 WP_101411799.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
VCBK1071_RS16785 483874..484329 + 456 WP_057553386.1 GNAT family N-acetyltransferase -
VCBK1071_RS16790 484485..485084 + 600 WP_101411801.1 porin family protein -
VCBK1071_RS16800 485256..485792 + 537 WP_033931679.1 GNAT family N-acetyltransferase -
VCBK1071_RS16805 486438..486659 + 222 WP_032467793.1 DUF1289 domain-containing protein -
VCBK1071_RS16820 486905..487432 + 528 WP_001232638.1 hypothetical protein -
VCBK1071_RS16830 487563..488051 + 489 WP_002051091.1 GNAT family N-acetyltransferase -
VCBK1071_RS20610 488207..488563 + 357 WP_033930535.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-84)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10406.11 Da        Isoelectric Point: 9.5084

>T293621 WP_000277238.1 NZ_LT897798:c483425-483156 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF

Download         Length: 270 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10119.59 Da        Isoelectric Point: 6.0728

>AT293621 WP_101411799.1 NZ_LT897798:c483696-483418 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVQQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A151JGK8

Antitoxin

Source ID Structure

References