Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 466561..467327 | Replicon | chromosome |
Accession | NZ_LT897798 | ||
Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | VCBK1071_RS16625 | Protein ID | WP_000982260.1 |
Coordinates | 466561..467058 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | VCBK1071_RS16630 | Protein ID | WP_088136754.1 |
Coordinates | 467055..467327 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCBK1071_RS20475 | 462815..462976 | + | 162 | Protein_488 | hypothetical protein | - |
VCBK1071_RS16595 | 462994..463254 | + | 261 | WP_032473247.1 | DUF3709 domain-containing protein | - |
VCBK1071_RS16600 | 463503..463823 | + | 321 | WP_162922770.1 | hypothetical protein | - |
VCBK1071_RS16605 | 463977..464417 | + | 441 | WP_101411771.1 | DUF1311 domain-containing protein | - |
VCBK1071_RS16615 | 464577..465329 | + | 753 | Protein_492 | SDR family oxidoreductase | - |
VCBK1071_RS16620 | 465486..466409 | + | 924 | WP_101411773.1 | arginase family protein | - |
VCBK1071_RS16625 | 466561..467058 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
VCBK1071_RS16630 | 467055..467327 | - | 273 | WP_088136754.1 | DUF1778 domain-containing protein | Antitoxin |
VCBK1071_RS16640 | 467582..468877 | + | 1296 | WP_101411777.1 | ATP-binding protein | - |
VCBK1071_RS16645 | 468882..469784 | + | 903 | WP_101411779.1 | DUF4435 domain-containing protein | - |
VCBK1071_RS16655 | 469965..470201 | - | 237 | WP_101411782.1 | RNA-binding protein | - |
VCBK1071_RS16665 | 470520..470924 | + | 405 | WP_080388968.1 | hypothetical protein | - |
VCBK1071_RS16670 | 471060..471596 | + | 537 | WP_101411786.1 | nucleotidyltransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
- | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T293620 WP_000982260.1 NZ_LT897798:c467058-466561 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|