293619

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 443369..443867 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag VCBK1071_RS16400 Protein ID WP_000589156.1
Coordinates 443369..443635 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag VCBK1071_RS16405 Protein ID WP_000643598.1
Coordinates 443622..443867 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16345 438398..438685 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
VCBK1071_RS16350 438696..439013 + 318 WP_001232701.1 HigA family addiction module antidote protein -
VCBK1071_RS16355 439151..439627 + 477 WP_101411715.1 GNAT family N-acetyltransferase -
VCBK1071_RS16360 439684..439869 + 186 WP_101411717.1 hypothetical protein -
VCBK1071_RS16365 439809..440046 + 238 Protein_450 DUF3709 domain-containing protein -
VCBK1071_RS20455 440269..440429 + 161 Protein_451 DUF3709 domain-containing protein -
VCBK1071_RS16375 440450..440683 + 234 WP_101411721.1 DUF3709 domain-containing protein -
VCBK1071_RS16380 440953..441429 + 477 WP_101411723.1 GNAT family N-acetyltransferase -
VCBK1071_RS16385 441575..442291 + 717 WP_101411725.1 RusA family crossover junction endodeoxyribonuclease -
VCBK1071_RS16395 442435..443187 + 753 WP_001035644.1 hypothetical protein -
VCBK1071_RS16400 443369..443635 + 267 WP_000589156.1 BrnT family toxin Toxin
VCBK1071_RS16405 443622..443867 + 246 WP_000643598.1 hypothetical protein Antitoxin
VCBK1071_RS16410 444013..444597 + 585 WP_101411727.1 hypothetical protein -
VCBK1071_RS16415 444738..445352 + 615 WP_101411729.1 hypothetical protein -
VCBK1071_RS16420 445353..445469 + 117 WP_080299869.1 DUF3265 domain-containing protein -
VCBK1071_RS16425 445479..445760 + 282 WP_001894429.1 DUF1289 domain-containing protein -
VCBK1071_RS16440 446019..446774 + 756 WP_172440205.1 PhzF family phenazine biosynthesis protein -
VCBK1071_RS16445 446841..447113 + 273 WP_197707186.1 DUF3709 domain-containing protein -
VCBK1071_RS16450 447541..447723 + 183 WP_101411737.1 DUF645 family protein -
VCBK1071_RS16455 447930..448499 + 570 WP_101411739.1 flavodoxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T293619 WP_000589156.1 NZ_LT897798:443369-443635 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT293619 WP_000643598.1 NZ_LT897798:443622-443867 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References