293617

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-higA/GNAT-HigA
Location 438696..439627 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name phd Uniprot ID -
Locus tag VCBK1071_RS16355 Protein ID WP_101411715.1
Coordinates 439151..439627 (+) Length 159 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag VCBK1071_RS16350 Protein ID WP_001232701.1
Coordinates 438696..439013 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS16305 434494..434817 + 324 WP_101411667.1 DUF3709 domain-containing protein -
VCBK1071_RS16310 435069..435518 + 450 WP_000480555.1 hypothetical protein -
VCBK1071_RS16320 435987..436097 + 111 WP_101412270.1 DUF3265 domain-containing protein -
VCBK1071_RS16325 436223..437290 + 1068 WP_145958155.1 hypothetical protein -
VCBK1071_RS16335 437633..438178 + 546 WP_101411711.1 GNAT family N-acetyltransferase -
VCBK1071_RS16340 438235..438357 + 123 WP_101411713.1 acetyltransferase -
VCBK1071_RS16345 438398..438685 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
VCBK1071_RS16350 438696..439013 + 318 WP_001232701.1 HigA family addiction module antidote protein Antitoxin
VCBK1071_RS16355 439151..439627 + 477 WP_101411715.1 GNAT family N-acetyltransferase Toxin
VCBK1071_RS16360 439684..439869 + 186 WP_101411717.1 hypothetical protein -
VCBK1071_RS16365 439809..440046 + 238 Protein_450 DUF3709 domain-containing protein -
VCBK1071_RS20455 440269..440429 + 161 Protein_451 DUF3709 domain-containing protein -
VCBK1071_RS16375 440450..440683 + 234 WP_101411721.1 DUF3709 domain-containing protein -
VCBK1071_RS16380 440953..441429 + 477 WP_101411723.1 GNAT family N-acetyltransferase -
VCBK1071_RS16385 441575..442291 + 717 WP_101411725.1 RusA family crossover junction endodeoxyribonuclease -
VCBK1071_RS16395 442435..443187 + 753 WP_001035644.1 hypothetical protein -
VCBK1071_RS16400 443369..443635 + 267 WP_000589156.1 BrnT family toxin -
VCBK1071_RS16405 443622..443867 + 246 WP_000643598.1 hypothetical protein -
VCBK1071_RS16410 444013..444597 + 585 WP_101411727.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(36-139)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 159 a.a.        Molecular weight: 18338.04 Da        Isoelectric Point: 5.7107

>T293617 WP_101411715.1 NZ_LT897798:439151-439627 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGGPAYVFPLTYEQIHSHCSKAEVFPYLLNVNGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVSTEIGTRAFNGKLWDLVRMEKRL

Download         Length: 477 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT293617 WP_001232701.1 NZ_LT897798:438696-439013 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References