Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-higA/GNAT-HigA |
Location | 438696..439627 | Replicon | chromosome |
Accession | NZ_LT897798 | ||
Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 |
Toxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | VCBK1071_RS16355 | Protein ID | WP_101411715.1 |
Coordinates | 439151..439627 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | VCBK1071_RS16350 | Protein ID | WP_001232701.1 |
Coordinates | 438696..439013 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCBK1071_RS16305 | 434494..434817 | + | 324 | WP_101411667.1 | DUF3709 domain-containing protein | - |
VCBK1071_RS16310 | 435069..435518 | + | 450 | WP_000480555.1 | hypothetical protein | - |
VCBK1071_RS16320 | 435987..436097 | + | 111 | WP_101412270.1 | DUF3265 domain-containing protein | - |
VCBK1071_RS16325 | 436223..437290 | + | 1068 | WP_145958155.1 | hypothetical protein | - |
VCBK1071_RS16335 | 437633..438178 | + | 546 | WP_101411711.1 | GNAT family N-acetyltransferase | - |
VCBK1071_RS16340 | 438235..438357 | + | 123 | WP_101411713.1 | acetyltransferase | - |
VCBK1071_RS16345 | 438398..438685 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VCBK1071_RS16350 | 438696..439013 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
VCBK1071_RS16355 | 439151..439627 | + | 477 | WP_101411715.1 | GNAT family N-acetyltransferase | Toxin |
VCBK1071_RS16360 | 439684..439869 | + | 186 | WP_101411717.1 | hypothetical protein | - |
VCBK1071_RS16365 | 439809..440046 | + | 238 | Protein_450 | DUF3709 domain-containing protein | - |
VCBK1071_RS20455 | 440269..440429 | + | 161 | Protein_451 | DUF3709 domain-containing protein | - |
VCBK1071_RS16375 | 440450..440683 | + | 234 | WP_101411721.1 | DUF3709 domain-containing protein | - |
VCBK1071_RS16380 | 440953..441429 | + | 477 | WP_101411723.1 | GNAT family N-acetyltransferase | - |
VCBK1071_RS16385 | 441575..442291 | + | 717 | WP_101411725.1 | RusA family crossover junction endodeoxyribonuclease | - |
VCBK1071_RS16395 | 442435..443187 | + | 753 | WP_001035644.1 | hypothetical protein | - |
VCBK1071_RS16400 | 443369..443635 | + | 267 | WP_000589156.1 | BrnT family toxin | - |
VCBK1071_RS16405 | 443622..443867 | + | 246 | WP_000643598.1 | hypothetical protein | - |
VCBK1071_RS16410 | 444013..444597 | + | 585 | WP_101411727.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
- | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18338.04 Da Isoelectric Point: 5.7107
>T293617 WP_101411715.1 NZ_LT897798:439151-439627 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGGPAYVFPLTYEQIHSHCSKAEVFPYLLNVNGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVSTEIGTRAFNGKLWDLVRMEKRL
MNLEEFQESDFDLLIKWIDSDELNYLWGGPAYVFPLTYEQIHSHCSKAEVFPYLLNVNGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVSTEIGTRAFNGKLWDLVRMEKRL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|