Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5597181..5597821 Replicon chromosome
Accession NZ_LT883143
Organism Pseudomonas aeruginosa C-NN2 isolate early isolate NN2 (clone C)

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PANN_RS26695 Protein ID WP_003105740.1
Coordinates 5597181..5597591 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag PANN_RS26700 Protein ID WP_003158175.1
Coordinates 5597591..5597821 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PANN_RS26650 5593023..5593220 + 198 WP_003105756.1 hypothetical protein -
PANN_RS26655 5593376..5594104 + 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
PANN_RS26660 5594110..5594658 + 549 WP_003105753.1 DUF3158 family protein -
PANN_RS26665 5594705..5595544 + 840 WP_003105750.1 Rha family transcriptional regulator -
PANN_RS26670 5595574..5596062 + 489 WP_003105748.1 single-stranded DNA-binding protein -
PANN_RS26675 5596170..5596415 + 246 WP_023102333.1 CrpP family protein -
PANN_RS26680 5596481..5596699 - 219 WP_003105747.1 hypothetical protein -
PANN_RS26690 5596899..5597159 - 261 WP_003105742.1 hypothetical protein -
PANN_RS26695 5597181..5597591 - 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
PANN_RS26700 5597591..5597821 - 231 WP_003158175.1 antitoxin Antitoxin
PANN_RS26705 5598077..5599996 + 1920 WP_004352838.1 type I DNA topoisomerase -
PANN_RS26710 5600304..5600513 + 210 WP_003105733.1 cold-shock protein -
PANN_RS26715 5600734..5602623 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul1 pilC / xcpA/pilD 5560958..5686548 125590


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T293611 WP_003105740.1 NZ_LT883143:c5597591-5597181 [Pseudomonas aeruginosa C-NN2]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT293611 WP_003158175.1 NZ_LT883143:c5597821-5597591 [Pseudomonas aeruginosa C-NN2]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References