Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2467122..2468164 | Replicon | chromosome |
Accession | NZ_LT883143 | ||
Organism | Pseudomonas aeruginosa C-NN2 isolate early isolate NN2 (clone C) |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PANN_RS11735 | Protein ID | WP_003153636.1 |
Coordinates | 2467589..2468164 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PANN_RS11730 | Protein ID | WP_003050245.1 |
Coordinates | 2467122..2467592 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PANN_RS11695 | 2462513..2463931 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
PANN_RS11700 | 2463921..2464832 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
PANN_RS11705 | 2464829..2465521 | - | 693 | WP_004350603.1 | TIGR03746 family integrating conjugative element protein | - |
PANN_RS11710 | 2465518..2465916 | - | 399 | WP_003153632.1 | TIGR03750 family conjugal transfer protein | - |
PANN_RS11715 | 2465929..2466288 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PANN_RS11720 | 2466305..2466538 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PANN_RS11725 | 2466535..2466918 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PANN_RS11730 | 2467122..2467592 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PANN_RS11735 | 2467589..2468164 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PANN_RS11740 | 2468182..2469096 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
PANN_RS11745 | 2469093..2469563 | + | 471 | WP_003153638.1 | hypothetical protein | - |
PANN_RS11750 | 2469560..2470060 | + | 501 | WP_003090159.1 | hypothetical protein | - |
PANN_RS11755 | 2470060..2470962 | + | 903 | WP_003153640.1 | nucleotidyltransferase domain-containing protein | - |
PANN_RS11760 | 2471001..2471726 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2412722..2517692 | 104970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T293608 WP_003153636.1 NZ_LT883143:2467589-2468164 [Pseudomonas aeruginosa C-NN2]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT293608 WP_003050245.1 NZ_LT883143:2467122-2467592 [Pseudomonas aeruginosa C-NN2]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|