Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 141668..142173 Replicon chromosome
Accession NZ_LT883143
Organism Pseudomonas aeruginosa C-NN2 isolate early isolate NN2 (clone C)

Toxin (Protein)


Gene name parE Uniprot ID A0A7M2ZNP4
Locus tag PANN_RS00640 Protein ID WP_009875660.1
Coordinates 141668..141949 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0H2ZJU8
Locus tag PANN_RS00645 Protein ID WP_003137009.1
Coordinates 141946..142173 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PANN_RS00615 136919..138268 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
PANN_RS00620 138317..139003 + 687 WP_004351997.1 FadR family transcriptional regulator -
PANN_RS00625 139104..139838 + 735 WP_003117208.1 GntR family transcriptional regulator -
PANN_RS00630 140042..140428 + 387 WP_014602345.1 aegerolysin family protein -
PANN_RS00635 140460..141368 - 909 WP_003083769.1 LysR family transcriptional regulator -
PANN_RS00640 141668..141949 - 282 WP_009875660.1 type II toxin-antitoxin system toxin ParE Toxin
PANN_RS00645 141946..142173 - 228 WP_003137009.1 CopG family ribbon-helix-helix protein Antitoxin
PANN_RS00650 142349..142969 - 621 WP_023086863.1 hypothetical protein -
PANN_RS00655 143070..143570 + 501 WP_003101228.1 LEA type 2 family protein -
PANN_RS00660 143643..143984 + 342 WP_003101229.1 alkylphosphonate utilization protein -
PANN_RS00665 144066..145493 - 1428 WP_003083784.1 GABA permease -
PANN_RS00670 145662..147155 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10461.25 Da        Isoelectric Point: 10.4670

>T293606 WP_009875660.1 NZ_LT883143:c141949-141668 [Pseudomonas aeruginosa C-NN2]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8526.56 Da        Isoelectric Point: 5.5740

>AT293606 WP_003137009.1 NZ_LT883143:c142173-141946 [Pseudomonas aeruginosa C-NN2]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHAEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7M2ZNP4

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2ZJU8

References