Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2417920..2418558 | Replicon | chromosome |
| Accession | NZ_LT883142 | ||
| Organism | Escherichia coli isolate 6666666.257727.embl | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EC1094V2_RS14040 | Protein ID | WP_000813794.1 |
| Coordinates | 2418382..2418558 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EC1094V2_RS14035 | Protein ID | WP_001270286.1 |
| Coordinates | 2417920..2418336 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1094V2_RS14015 | 2413072..2414013 | - | 942 | WP_032177241.1 | ABC transporter permease | - |
| EC1094V2_RS14020 | 2414014..2415027 | - | 1014 | WP_032177240.1 | ABC transporter ATP-binding protein | - |
| EC1094V2_RS14025 | 2415045..2416190 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| EC1094V2_RS14030 | 2416435..2417841 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| EC1094V2_RS14035 | 2417920..2418336 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EC1094V2_RS14040 | 2418382..2418558 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EC1094V2_RS14045 | 2418780..2419010 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| EC1094V2_RS14050 | 2419102..2421063 | - | 1962 | WP_001515270.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EC1094V2_RS14055 | 2421136..2421672 | - | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
| EC1094V2_RS14060 | 2421725..2422939 | + | 1215 | WP_072144128.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T293601 WP_000813794.1 NZ_LT883142:c2418558-2418382 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT293601 WP_001270286.1 NZ_LT883142:c2418336-2417920 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|