Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1773091..1773923 Replicon chromosome
Accession NZ_LT883142
Organism Escherichia coli isolate 6666666.257727.embl

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag EC1094V2_RS10615 Protein ID WP_000854765.1
Coordinates 1773091..1773465 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag EC1094V2_RS10620 Protein ID WP_001295723.1
Coordinates 1773555..1773923 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1094V2_RS10585 1769011..1770546 - 1536 WP_101430442.1 IS66 family transposase -
EC1094V2_RS10590 1770596..1770943 - 348 WP_000609174.1 IS66 family insertion sequence element accessory protein TnpB -
EC1094V2_RS10595 1770940..1771323 - 384 WP_001201739.1 IS66 family insertion sequence hypothetical protein -
EC1094V2_RS10600 1771408..1771737 + 330 Protein_1639 IS21 family transposase -
EC1094V2_RS10605 1771752..1772498 + 747 Protein_1640 IS21-like element ISEc12 family helper ATPase IstB -
EC1094V2_RS27090 1772762..1772875 - 114 WP_001161660.1 DUF957 domain-containing protein -
EC1094V2_RS10610 1772888..1773094 - 207 WP_000976829.1 hypothetical protein -
EC1094V2_RS10615 1773091..1773465 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
EC1094V2_RS10620 1773555..1773923 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EC1094V2_RS10625 1774086..1774307 - 222 WP_000692345.1 DUF987 domain-containing protein -
EC1094V2_RS10630 1774370..1774846 - 477 WP_001186774.1 RadC family protein -
EC1094V2_RS10635 1774862..1775335 - 474 WP_000855059.1 antirestriction protein -
EC1094V2_RS10645 1775677..1776495 - 819 WP_096321617.1 DUF945 domain-containing protein -
EC1094V2_RS10655 1776648..1776806 - 159 WP_001323397.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1770940..1789896 18956


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T293594 WP_000854765.1 NZ_LT883142:c1773465-1773091 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT293594 WP_001295723.1 NZ_LT883142:c1773923-1773555 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References