Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1773091..1773923 | Replicon | chromosome |
| Accession | NZ_LT883142 | ||
| Organism | Escherichia coli isolate 6666666.257727.embl | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | EC1094V2_RS10615 | Protein ID | WP_000854765.1 |
| Coordinates | 1773091..1773465 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | EC1094V2_RS10620 | Protein ID | WP_001295723.1 |
| Coordinates | 1773555..1773923 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1094V2_RS10585 | 1769011..1770546 | - | 1536 | WP_101430442.1 | IS66 family transposase | - |
| EC1094V2_RS10590 | 1770596..1770943 | - | 348 | WP_000609174.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| EC1094V2_RS10595 | 1770940..1771323 | - | 384 | WP_001201739.1 | IS66 family insertion sequence hypothetical protein | - |
| EC1094V2_RS10600 | 1771408..1771737 | + | 330 | Protein_1639 | IS21 family transposase | - |
| EC1094V2_RS10605 | 1771752..1772498 | + | 747 | Protein_1640 | IS21-like element ISEc12 family helper ATPase IstB | - |
| EC1094V2_RS27090 | 1772762..1772875 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| EC1094V2_RS10610 | 1772888..1773094 | - | 207 | WP_000976829.1 | hypothetical protein | - |
| EC1094V2_RS10615 | 1773091..1773465 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| EC1094V2_RS10620 | 1773555..1773923 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EC1094V2_RS10625 | 1774086..1774307 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EC1094V2_RS10630 | 1774370..1774846 | - | 477 | WP_001186774.1 | RadC family protein | - |
| EC1094V2_RS10635 | 1774862..1775335 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| EC1094V2_RS10645 | 1775677..1776495 | - | 819 | WP_096321617.1 | DUF945 domain-containing protein | - |
| EC1094V2_RS10655 | 1776648..1776806 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1770940..1789896 | 18956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T293594 WP_000854765.1 NZ_LT883142:c1773465-1773091 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT293594 WP_001295723.1 NZ_LT883142:c1773923-1773555 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|