Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 84301..84902 Replicon plasmid I
Accession NZ_LT883139
Organism Escherichia coli isolate 6666666.257727.embl

Toxin (Protein)


Gene name doc Uniprot ID Q47172
Locus tag EC1094V2_RS00500 Protein ID WP_001694510.1
Coordinates 84522..84902 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag EC1094V2_RS00495 Protein ID WP_001190712.1
Coordinates 84301..84522 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1094V2_RS00485 81354..82565 - 1212 WP_023157127.1 restriction endonuclease subunit S -
EC1094V2_RS00490 82562..84118 - 1557 WP_021553349.1 type I restriction-modification system subunit M -
EC1094V2_RS00495 84301..84522 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EC1094V2_RS00500 84522..84902 + 381 WP_001694510.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EC1094V2_RS00505 84907..85086 + 180 WP_000113018.1 hypothetical protein -
EC1094V2_RS00510 85114..86157 + 1044 WP_000648832.1 DUF968 domain-containing protein -
EC1094V2_RS00520 86301..86998 + 698 Protein_85 IS1 family transposase -
EC1094V2_RS00525 87089..87298 - 210 WP_021553350.1 helix-turn-helix domain-containing protein -
EC1094V2_RS00530 88037..88317 + 281 Protein_87 hypothetical protein -
EC1094V2_RS00535 88558..88995 - 438 WP_024195570.1 GyrI-like domain-containing protein -
EC1094V2_RS00540 89090..89787 - 698 Protein_89 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..118720 118720


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13616.35 Da        Isoelectric Point: 5.1514

>T293586 WP_001694510.1 NZ_LT883139:84522-84902 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT293586 WP_001190712.1 NZ_LT883139:84301-84522 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A737M8C8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References