Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 7510956..7511976 | Replicon | chromosome |
Accession | NZ_LT859959 | ||
Organism | Bradyrhizobium sp. ORS 285 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | BRAD285_RS33815 | Protein ID | WP_035646931.1 |
Coordinates | 7510956..7511534 (-) | Length | 193 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | - |
Locus tag | BRAD285_RS33820 | Protein ID | WP_035646914.1 |
Coordinates | 7511530..7511976 (-) | Length | 149 a.a. |
Genomic Context
Location: 7506035..7506358 (324 bp)
Type: Others
Protein ID: WP_006612657.1
Type: Others
Protein ID: WP_006612657.1
Location: 7506392..7507348 (957 bp)
Type: Others
Protein ID: WP_006612656.1
Type: Others
Protein ID: WP_006612656.1
Location: 7513921..7514991 (1071 bp)
Type: Others
Protein ID: WP_006612650.1
Type: Others
Protein ID: WP_006612650.1
Location: 7507965..7510205 (2241 bp)
Type: Others
Protein ID: WP_006612655.1
Type: Others
Protein ID: WP_006612655.1
Location: 7510340..7510819 (480 bp)
Type: Others
Protein ID: WP_035646916.1
Type: Others
Protein ID: WP_035646916.1
Location: 7510956..7511534 (579 bp)
Type: Toxin
Protein ID: WP_035646931.1
Type: Toxin
Protein ID: WP_035646931.1
Location: 7511530..7511976 (447 bp)
Type: Antitoxin
Protein ID: WP_035646914.1
Type: Antitoxin
Protein ID: WP_035646914.1
Location: 7512156..7513694 (1539 bp)
Type: Others
Protein ID: WP_006612651.1
Type: Others
Protein ID: WP_006612651.1
Location: 7515007..7515780 (774 bp)
Type: Others
Protein ID: WP_087877739.1
Type: Others
Protein ID: WP_087877739.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRAD285_RS33795 | 7506035..7506358 | + | 324 | WP_006612657.1 | phosphoribosyl-ATP diphosphatase | - |
BRAD285_RS33800 | 7506392..7507348 | + | 957 | WP_006612656.1 | type I pantothenate kinase | - |
BRAD285_RS33805 | 7507965..7510205 | - | 2241 | WP_006612655.1 | response regulator | - |
BRAD285_RS33810 | 7510340..7510819 | - | 480 | WP_035646916.1 | hypothetical protein | - |
BRAD285_RS33815 | 7510956..7511534 | - | 579 | WP_035646931.1 | PIN domain-containing protein | Toxin |
BRAD285_RS33820 | 7511530..7511976 | - | 447 | WP_035646914.1 | helix-turn-helix domain-containing protein | Antitoxin |
BRAD285_RS33825 | 7512156..7513694 | - | 1539 | WP_006612651.1 | YifB family Mg chelatase-like AAA ATPase | - |
BRAD285_RS33830 | 7513921..7514991 | + | 1071 | WP_006612650.1 | DUF2336 domain-containing protein | - |
BRAD285_RS33835 | 7515007..7515780 | - | 774 | WP_087877739.1 | outer membrane lipoprotein carrier protein LolA | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 193 a.a. Molecular weight: 21778.00 Da Isoelectric Point: 6.3290
>T293584 WP_035646931.1 NZ_LT859959:c7511534-7510956 [Bradyrhizobium sp. ORS 285]
ISNHSRYTVILDACTLYPAPLRDLLMETASMGLFRAKWSDRIHDEWISNLLAKRPDLDLAKLERTRHLMNNAVPDCLVTG
YESIIDALDLPDEDDRHVLAAGIHCGADAIVTFNVKDFPVETLAIHHIEPQHPDEFLVHQFGLNEAAVLNAARRCRLRLK
RNPRDAIQYLLALERCGLPQTVAHLRAYSEVI
ISNHSRYTVILDACTLYPAPLRDLLMETASMGLFRAKWSDRIHDEWISNLLAKRPDLDLAKLERTRHLMNNAVPDCLVTG
YESIIDALDLPDEDDRHVLAAGIHCGADAIVTFNVKDFPVETLAIHHIEPQHPDEFLVHQFGLNEAAVLNAARRCRLRLK
RNPRDAIQYLLALERCGLPQTVAHLRAYSEVI
Download Length: 579 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16784.17 Da Isoelectric Point: 6.6512
>AT293584 WP_035646914.1 NZ_LT859959:c7511976-7511530 [Bradyrhizobium sp. ORS 285]
MSARDLERPITLPSKEDTALAQEASRAIATKQPSELKVRLDDGQELTLPKAATRLIAHLLTEMAQGNAVTIIPIHAVLTT
QEAADYLNVSRPHLVSLLEEKRIPYHKVGTHRRVRFQDLVDYRAAFEKRRREIMEELAAQAEQEDMGY
MSARDLERPITLPSKEDTALAQEASRAIATKQPSELKVRLDDGQELTLPKAATRLIAHLLTEMAQGNAVTIIPIHAVLTT
QEAADYLNVSRPHLVSLLEEKRIPYHKVGTHRRVRFQDLVDYRAAFEKRRREIMEELAAQAEQEDMGY
Download Length: 447 bp