Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 6104475..6105113 | Replicon | chromosome |
Accession | NZ_LT859959 | ||
Organism | Bradyrhizobium sp. ORS 285 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A1Y6KML6 |
Locus tag | BRAD285_RS27500 | Protein ID | WP_006611370.1 |
Coordinates | 6104820..6105113 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1Y6KMC9 |
Locus tag | BRAD285_RS27495 | Protein ID | WP_006611371.1 |
Coordinates | 6104475..6104816 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRAD285_RS27475 | 6099499..6100491 | - | 993 | WP_006610362.1 | TorF family putative porin | - |
BRAD285_RS27480 | 6100918..6101394 | - | 477 | WP_006610361.1 | hypothetical protein | - |
BRAD285_RS27485 | 6101468..6102790 | - | 1323 | WP_087877672.1 | glycolate oxidase subunit GlcF | - |
BRAD285_RS27490 | 6102787..6104025 | - | 1239 | WP_006611372.1 | FAD-binding protein | - |
BRAD285_RS27495 | 6104475..6104816 | - | 342 | WP_006611371.1 | putative addiction module antidote protein | Antitoxin |
BRAD285_RS27500 | 6104820..6105113 | - | 294 | WP_006611370.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BRAD285_RS27505 | 6105544..6106446 | + | 903 | WP_006611369.1 | Sel1 repeat protein | - |
BRAD285_RS27510 | 6106598..6106804 | - | 207 | WP_035645897.1 | hypothetical protein | - |
BRAD285_RS27515 | 6107998..6109491 | - | 1494 | WP_006611368.1 | FAD-binding protein | - |
BRAD285_RS27520 | 6109703..6110098 | + | 396 | WP_006611367.1 | cytochrome c family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10821.45 Da Isoelectric Point: 10.3096
>T293583 WP_006611370.1 NZ_LT859959:c6105113-6104820 [Bradyrhizobium sp. ORS 285]
MVEIRQTAEFKAWLLGLRDLKAKARIAARIERAANGNLGDSKPVGEGVSEMRIDYGPGYRIYYRQRGDVLVILLCGGDKS
TQQSDIRRAQALAKREA
MVEIRQTAEFKAWLLGLRDLKAKARIAARIERAANGNLGDSKPVGEGVSEMRIDYGPGYRIYYRQRGDVLVILLCGGDKS
TQQSDIRRAQALAKREA
Download Length: 294 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 11943.67 Da Isoelectric Point: 10.4599
>AT293583 WP_006611371.1 NZ_LT859959:c6104816-6104475 [Bradyrhizobium sp. ORS 285]
MATTRFDAAEYLAEPEAQAEFLAAALEDGTADEIRAAINTIARARGMSDLAKATGIRREQLYRALGEDGNPEFATILTVL
RALGVKLTSAPAKGASKAAPKRKTAKKVGRRAA
MATTRFDAAEYLAEPEAQAEFLAAALEDGTADEIRAAINTIARARGMSDLAKATGIRREQLYRALGEDGNPEFATILTVL
RALGVKLTSAPAKGASKAAPKRKTAKKVGRRAA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6KML6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6KMC9 |