Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 5980776..5981371 | Replicon | chromosome |
| Accession | NZ_LT859959 | ||
| Organism | Bradyrhizobium sp. ORS 285 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Y6KPU8 |
| Locus tag | BRAD285_RS26865 | Protein ID | WP_006609255.1 |
| Coordinates | 5981183..5981371 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1Y6KMD1 |
| Locus tag | BRAD285_RS26860 | Protein ID | WP_006609254.1 |
| Coordinates | 5980776..5981177 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BRAD285_RS26840 | 5975818..5978904 | + | 3087 | WP_006609214.1 | excinuclease ABC subunit UvrB | - |
| BRAD285_RS26845 | 5979263..5979463 | - | 201 | WP_006609250.1 | SEC-C domain-containing protein | - |
| BRAD285_RS26850 | 5979741..5980259 | + | 519 | WP_006609251.1 | transposase | - |
| BRAD285_RS26860 | 5980776..5981177 | - | 402 | WP_006609254.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BRAD285_RS26865 | 5981183..5981371 | - | 189 | WP_006609255.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BRAD285_RS26875 | 5982324..5983277 | - | 954 | WP_006609256.1 | ribose-phosphate pyrophosphokinase | - |
| BRAD285_RS26880 | 5983443..5984072 | - | 630 | WP_006609257.1 | hypothetical protein | - |
| BRAD285_RS26885 | 5984196..5984963 | - | 768 | WP_172889816.1 | peptidoglycan editing factor PgeF | - |
| BRAD285_RS26890 | 5984963..5986090 | - | 1128 | WP_006609259.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6955.11 Da Isoelectric Point: 11.7334
>T293582 WP_006609255.1 NZ_LT859959:c5981371-5981183 [Bradyrhizobium sp. ORS 285]
MNSRDVISVLQRDGWVQIAQKGSHVQFKHPSKKGRVTVPHPSRDLPIGTLKSIEKQAGLKLR
MNSRDVISVLQRDGWVQIAQKGSHVQFKHPSKKGRVTVPHPSRDLPIGTLKSIEKQAGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14365.30 Da Isoelectric Point: 4.7663
>AT293582 WP_006609254.1 NZ_LT859959:c5981177-5980776 [Bradyrhizobium sp. ORS 285]
MRYYIGLIHKDADSHFGVSFPDLPGVVTAGTTLDDARVMAEEALALHIEGLVEDGEAIPEPSSLEQIMSHRTNRSGVAVL
VPAKVEQSRAVRVNVTLPEDVLAQIDRYAEAHGFTRSGLLVQAAKKLMTDEAA
MRYYIGLIHKDADSHFGVSFPDLPGVVTAGTTLDDARVMAEEALALHIEGLVEDGEAIPEPSSLEQIMSHRTNRSGVAVL
VPAKVEQSRAVRVNVTLPEDVLAQIDRYAEAHGFTRSGLLVQAAKKLMTDEAA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6KPU8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6KMD1 |