Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
Location | 4076448..4077073 | Replicon | chromosome |
Accession | NZ_LT859959 | ||
Organism | Bradyrhizobium sp. ORS 285 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1Y6KH19 |
Locus tag | BRAD285_RS18385 | Protein ID | WP_006611051.1 |
Coordinates | 4076675..4077073 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1Y6KH08 |
Locus tag | BRAD285_RS18380 | Protein ID | WP_006611050.1 |
Coordinates | 4076448..4076678 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRAD285_RS18350 | 4071536..4071964 | - | 429 | WP_006611045.1 | PaaI family thioesterase | - |
BRAD285_RS18355 | 4072035..4072856 | + | 822 | WP_035645698.1 | enoyl-CoA hydratase | - |
BRAD285_RS18360 | 4072985..4073569 | + | 585 | WP_006611047.1 | CoA-binding protein | - |
BRAD285_RS18365 | 4073797..4075080 | + | 1284 | WP_006611048.1 | O-acetylhomoserine aminocarboxypropyltransferase | - |
BRAD285_RS18370 | 4075519..4075713 | - | 195 | WP_035645702.1 | hypothetical protein | - |
BRAD285_RS18375 | 4076032..4076367 | + | 336 | WP_006611049.1 | hypothetical protein | - |
BRAD285_RS18380 | 4076448..4076678 | + | 231 | WP_006611050.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
BRAD285_RS18385 | 4076675..4077073 | + | 399 | WP_006611051.1 | PIN domain-containing protein | Toxin |
BRAD285_RS18390 | 4077641..4078729 | - | 1089 | WP_006611052.1 | COX15/CtaA family protein | - |
BRAD285_RS18395 | 4078832..4079050 | + | 219 | WP_006611053.1 | DUF2842 domain-containing protein | - |
BRAD285_RS18400 | 4079065..4080126 | - | 1062 | WP_006611054.1 | polysaccharide deacetylase family protein | - |
BRAD285_RS18405 | 4080414..4081634 | + | 1221 | WP_006611055.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14510.45 Da Isoelectric Point: 4.7884
>T293581 WP_006611051.1 NZ_LT859959:4076675-4077073 [Bradyrhizobium sp. ORS 285]
VSTFFDSNILVYAYSTDPRRDRAIDVIADGGVISVQVLNEFTNVLRRKQKLDWPTVEAALSSIIFRFPDARPLTVATHTT
AIALARDHGLQFYDALIVASALDADCDTLVSEDLQHGRSFGSLTIVNPFLGL
VSTFFDSNILVYAYSTDPRRDRAIDVIADGGVISVQVLNEFTNVLRRKQKLDWPTVEAALSSIIFRFPDARPLTVATHTT
AIALARDHGLQFYDALIVASALDADCDTLVSEDLQHGRSFGSLTIVNPFLGL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6KH19 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6KH08 |