Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parE_1-relB/RelE(toxin) |
Location | 2045996..2046471 | Replicon | chromosome |
Accession | NZ_LT855380 | ||
Organism | Pseudomonas viridiflava strain CFBP 1590 isolate E12-5 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | - |
Locus tag | CFBP1590_RS09705 | Protein ID | WP_080665244.1 |
Coordinates | 2046190..2046471 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A5E7EZR3 |
Locus tag | CFBP1590_RS09700 | Protein ID | WP_029242986.1 |
Coordinates | 2045996..2046190 (+) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP1590_RS09680 | 2041024..2041503 | + | 480 | WP_058431249.1 | ATP-binding protein | - |
CFBP1590_RS09685 | 2041572..2043743 | - | 2172 | WP_058431250.1 | TonB-dependent siderophore receptor | - |
CFBP1590_RS09690 | 2044010..2045251 | + | 1242 | WP_088234920.1 | M20/M25/M40 family metallo-hydrolase | - |
CFBP1590_RS09695 | 2045349..2045759 | + | 411 | WP_025995307.1 | S24 family peptidase | - |
CFBP1590_RS09700 | 2045996..2046190 | + | 195 | WP_029242986.1 | hypothetical protein | Antitoxin |
CFBP1590_RS09705 | 2046190..2046471 | + | 282 | WP_080665244.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP1590_RS09715 | 2046880..2047890 | + | 1011 | WP_088234921.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
CFBP1590_RS09720 | 2048036..2048467 | + | 432 | WP_025995310.1 | universal stress protein | - |
CFBP1590_RS09725 | 2048476..2048940 | - | 465 | WP_004881182.1 | response regulator | - |
CFBP1590_RS09730 | 2048937..2051264 | - | 2328 | WP_088234922.1 | PAS domain S-box protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10517.27 Da Isoelectric Point: 9.8796
>T293579 WP_080665244.1 NZ_LT855380:2046190-2046471 [Pseudomonas viridiflava]
MLPIVWLQAAVNDLSSIILYISNENPSAARRLKSRLQAAPLPLVEHPYLFPLGRVSGTRELVAHPNYIIVYRIASDRVEI
VNVLHSRQTYPLT
MLPIVWLQAAVNDLSSIILYISNENPSAARRLKSRLQAAPLPLVEHPYLFPLGRVSGTRELVAHPNYIIVYRIASDRVEI
VNVLHSRQTYPLT
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|