Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1318768..1319466 | Replicon | chromosome |
| Accession | NZ_LT855380 | ||
| Organism | Pseudomonas viridiflava strain CFBP 1590 isolate E12-5 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | CFBP1590_RS06255 | Protein ID | WP_004881256.1 |
| Coordinates | 1319284..1319466 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5E6SCC0 |
| Locus tag | CFBP1590_RS06250 | Protein ID | WP_025996829.1 |
| Coordinates | 1318768..1319178 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP1590_RS06230 | 1314548..1315717 | + | 1170 | WP_004881265.1 | mandelate racemase/muconate lactonizing enzyme family protein | - |
| CFBP1590_RS06235 | 1315795..1317111 | + | 1317 | WP_088234668.1 | C4-dicarboxylate transporter DctA | - |
| CFBP1590_RS06240 | 1317162..1317473 | - | 312 | WP_167383111.1 | helix-turn-helix domain-containing protein | - |
| CFBP1590_RS06245 | 1317551..1318642 | + | 1092 | WP_088234669.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
| CFBP1590_RS06250 | 1318768..1319178 | - | 411 | WP_025996829.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| CFBP1590_RS06255 | 1319284..1319466 | - | 183 | WP_004881256.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| CFBP1590_RS06260 | 1319752..1322688 | - | 2937 | WP_167383112.1 | autotransporter domain-containing protein | - |
| CFBP1590_RS06265 | 1323095..1323595 | + | 501 | WP_069144671.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6888.95 Da Isoelectric Point: 10.5417
>T293578 WP_004881256.1 NZ_LT855380:c1319466-1319284 [Pseudomonas viridiflava]
MRSREMIRTIEDDGWYLVATKGSHHQYKHSSKPGRVTIKHPDSDIPIKTMNSILKQAGLK
MRSREMIRTIEDDGWYLVATKGSHHQYKHSSKPGRVTIKHPDSDIPIKTMNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14851.63 Da Isoelectric Point: 4.6312
>AT293578 WP_025996829.1 NZ_LT855380:c1319178-1318768 [Pseudomonas viridiflava]
MKFTVVLHKDADSDYGVTVPDVPGCFSAGSSVSEALESVKEALSLHFEGLVADGAPLPNAQAIDIHMANPDYEDGIWAVV
EFDVTPYFGKSVRFNATLPEHLLAKIDERVKTDHRYASRSGFLAAAALNELHTEYR
MKFTVVLHKDADSDYGVTVPDVPGCFSAGSSVSEALESVKEALSLHFEGLVADGAPLPNAQAIDIHMANPDYEDGIWAVV
EFDVTPYFGKSVRFNATLPEHLLAKIDERVKTDHRYASRSGFLAAAALNELHTEYR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|