Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 584530..585141 | Replicon | chromosome |
Accession | NZ_LT855380 | ||
Organism | Pseudomonas viridiflava strain CFBP 1590 isolate E12-5 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q4ZME8 |
Locus tag | CFBP1590_RS02815 | Protein ID | WP_003304103.1 |
Coordinates | 584791..585141 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q4ZME7 |
Locus tag | CFBP1590_RS02810 | Protein ID | WP_002556076.1 |
Coordinates | 584530..584778 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP1590_RS02785 | 579764..580660 | + | 897 | WP_017709553.1 | LysR family transcriptional regulator | - |
CFBP1590_RS02790 | 580818..581810 | + | 993 | WP_017709554.1 | YncE family protein | - |
CFBP1590_RS02795 | 582135..582515 | + | 381 | WP_010924793.1 | hypothetical protein | - |
CFBP1590_RS02800 | 582996..583202 | + | 207 | WP_161806366.1 | hypothetical protein | - |
CFBP1590_RS02805 | 583231..584193 | - | 963 | WP_010924794.1 | tyrosine-type recombinase/integrase | - |
CFBP1590_RS02810 | 584530..584778 | + | 249 | WP_002556076.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
CFBP1590_RS02815 | 584791..585141 | + | 351 | WP_003304103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP1590_RS02825 | 585793..587178 | - | 1386 | WP_103365183.1 | P-type conjugative transfer protein TrbL | - |
CFBP1590_RS02830 | 587382..588137 | - | 756 | WP_088234448.1 | P-type conjugative transfer protein TrbJ | - |
CFBP1590_RS02835 | 588178..588552 | - | 375 | WP_088234449.1 | conjugal transfer transcriptional regulator TraJ | - |
CFBP1590_RS02840 | 588845..589123 | - | 279 | WP_088234450.1 | conjugal transfer protein TraK | - |
CFBP1590_RS02845 | 589190..589915 | - | 726 | WP_088236353.1 | phage replication protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 564726..591629 | 26903 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12973.76 Da Isoelectric Point: 4.7690
>T293577 WP_003304103.1 NZ_LT855380:584791-585141 [Pseudomonas viridiflava]
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GDS9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GM89 |