Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 16983..17533 Replicon plasmid pPD5205-21
Accession NZ_LT853887
Organism Xanthomonas fragariae strain PD5205

Toxin (Protein)


Gene name parE Uniprot ID A0A1Y6HCU7
Locus tag PD5205_RS20065 Protein ID WP_002804295.1
Coordinates 16983..17267 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1Y6HDJ6
Locus tag PD5205_RS20070 Protein ID WP_002804296.1
Coordinates 17255..17533 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PD5205_RS20040 12589..12990 - 402 WP_002804331.1 hypothetical protein -
PD5205_RS21080 13042..13485 + 444 WP_145954081.1 hypothetical protein -
PD5205_RS21545 13492..13656 + 165 WP_156775378.1 hypothetical protein -
PD5205_RS20045 13844..14419 + 576 WP_040762337.1 recombinase family protein -
PD5205_RS20050 14430..14696 + 267 WP_002804333.1 hypothetical protein -
PD5205_RS20055 14831..16546 + 1716 WP_083215115.1 AAA family ATPase -
PD5205_RS20060 16615..16797 + 183 WP_134656646.1 hypothetical protein -
PD5205_RS20065 16983..17267 - 285 WP_002804295.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PD5205_RS20070 17255..17533 - 279 WP_002804296.1 CopG family ribbon-helix-helix protein Antitoxin
PD5205_RS21650 17817..18365 + 549 WP_002804297.1 hypothetical protein -
PD5205_RS20080 18355..19002 + 648 WP_002804298.1 recombinase family protein -
PD5205_RS21550 18999..19136 + 138 WP_167699514.1 hypothetical protein -
PD5205_RS20085 19246..19865 + 620 Protein_31 ParA family protein -
PD5205_RS20090 19869..20231 + 363 WP_002804300.1 hypothetical protein -
PD5205_RS20095 20314..20637 + 324 WP_002804301.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..20830 20830
- flank IS/Tn - - 13805..14419 614


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-93)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10801.49 Da        Isoelectric Point: 10.0858

>T293573 WP_002804295.1 NZ_LT853887:c17267-16983 [Xanthomonas fragariae]
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA

Download         Length: 285 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10760.05 Da        Isoelectric Point: 5.1991

>AT293573 WP_002804296.1 NZ_LT853887:c17533-17255 [Xanthomonas fragariae]
MASPTSLKLDDELKGRVQHLAQTQRRTPHWIMREAIAQYVEREEKRETFKQDALRAWEDYQRTGLHLTLEETDAWLAKLE
AGEDAELPACHT

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Y6HCU7

Antitoxin

Source ID Structure
AlphaFold DB A0A1Y6HDJ6

References