Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 16983..17533 | Replicon | plasmid pPD5205-21 |
| Accession | NZ_LT853887 | ||
| Organism | Xanthomonas fragariae strain PD5205 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A1Y6HCU7 |
| Locus tag | PD5205_RS20065 | Protein ID | WP_002804295.1 |
| Coordinates | 16983..17267 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1Y6HDJ6 |
| Locus tag | PD5205_RS20070 | Protein ID | WP_002804296.1 |
| Coordinates | 17255..17533 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PD5205_RS20040 | 12589..12990 | - | 402 | WP_002804331.1 | hypothetical protein | - |
| PD5205_RS21080 | 13042..13485 | + | 444 | WP_145954081.1 | hypothetical protein | - |
| PD5205_RS21545 | 13492..13656 | + | 165 | WP_156775378.1 | hypothetical protein | - |
| PD5205_RS20045 | 13844..14419 | + | 576 | WP_040762337.1 | recombinase family protein | - |
| PD5205_RS20050 | 14430..14696 | + | 267 | WP_002804333.1 | hypothetical protein | - |
| PD5205_RS20055 | 14831..16546 | + | 1716 | WP_083215115.1 | AAA family ATPase | - |
| PD5205_RS20060 | 16615..16797 | + | 183 | WP_134656646.1 | hypothetical protein | - |
| PD5205_RS20065 | 16983..17267 | - | 285 | WP_002804295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PD5205_RS20070 | 17255..17533 | - | 279 | WP_002804296.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PD5205_RS21650 | 17817..18365 | + | 549 | WP_002804297.1 | hypothetical protein | - |
| PD5205_RS20080 | 18355..19002 | + | 648 | WP_002804298.1 | recombinase family protein | - |
| PD5205_RS21550 | 18999..19136 | + | 138 | WP_167699514.1 | hypothetical protein | - |
| PD5205_RS20085 | 19246..19865 | + | 620 | Protein_31 | ParA family protein | - |
| PD5205_RS20090 | 19869..20231 | + | 363 | WP_002804300.1 | hypothetical protein | - |
| PD5205_RS20095 | 20314..20637 | + | 324 | WP_002804301.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..20830 | 20830 | |
| - | flank | IS/Tn | - | - | 13805..14419 | 614 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10801.49 Da Isoelectric Point: 10.0858
>T293573 WP_002804295.1 NZ_LT853887:c17267-16983 [Xanthomonas fragariae]
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HCU7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HDJ6 |