Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 11238..11817 | Replicon | plasmid pPD5205-30 |
Accession | NZ_LT853886 | ||
Organism | Xanthomonas fragariae strain PD5205 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1Y6HD38 |
Locus tag | PD5205_RS19815 | Protein ID | WP_002805372.1 |
Coordinates | 11238..11531 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1Y6HUN4 |
Locus tag | PD5205_RS19820 | Protein ID | WP_002805369.1 |
Coordinates | 11518..11817 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PD5205_RS19780 | 6472..7023 | + | 552 | WP_065975505.1 | plasmid mobilization relaxosome protein MobC | - |
PD5205_RS19785 | 7010..8029 | + | 1020 | WP_052032118.1 | relaxase/mobilization nuclease domain-containing protein | - |
PD5205_RS19795 | 8687..9286 | + | 600 | WP_065975504.1 | hypothetical protein | - |
PD5205_RS19805 | 9790..10542 | - | 753 | WP_065975503.1 | hypothetical protein | - |
PD5205_RS19810 | 10763..10987 | + | 225 | WP_002805375.1 | hypothetical protein | - |
PD5205_RS21525 | 10984..11160 | - | 177 | WP_156775376.1 | hypothetical protein | - |
PD5205_RS19815 | 11238..11531 | - | 294 | WP_002805372.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PD5205_RS19820 | 11518..11817 | - | 300 | WP_002805369.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PD5205_RS19830 | 12296..12721 | + | 426 | WP_167699513.1 | antitoxin VbhA family protein | - |
PD5205_RS19835 | 12763..13338 | + | 576 | WP_065975506.1 | recombinase family protein | - |
PD5205_RS19840 | 13499..13768 | - | 270 | WP_052032117.1 | DUF3717 domain-containing protein | - |
PD5205_RS19845 | 13765..14388 | - | 624 | WP_002805358.1 | transglycosylase SLT domain-containing protein | - |
PD5205_RS19850 | 14385..16229 | - | 1845 | WP_065975501.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..30469 | 30469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10915.49 Da Isoelectric Point: 5.1409
>T293572 WP_002805372.1 NZ_LT853886:c11531-11238 [Xanthomonas fragariae]
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HD38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HUN4 |