Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2004008..2004678 | Replicon | chromosome |
Accession | NZ_LT853885 | ||
Organism | Xanthomonas fragariae strain PD5205 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1Y6H9H7 |
Locus tag | PD5205_RS09425 | Protein ID | WP_002805728.1 |
Coordinates | 2004259..2004678 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1Y6HLT7 |
Locus tag | PD5205_RS09420 | Protein ID | WP_002805732.1 |
Coordinates | 2004008..2004262 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PD5205_RS09395 | 1999593..2000597 | - | 1005 | WP_002805744.1 | hypothetical protein | - |
PD5205_RS09400 | 2000679..2000912 | + | 234 | WP_002805742.1 | hypothetical protein | - |
PD5205_RS09405 | 2000916..2001794 | + | 879 | WP_002805739.1 | helicase RepA family protein | - |
PD5205_RS09410 | 2001766..2002653 | + | 888 | WP_172404498.1 | replication protein C | - |
PD5205_RS09415 | 2003315..2003596 | + | 282 | WP_002805735.1 | TraK family protein | - |
PD5205_RS09420 | 2004008..2004262 | + | 255 | WP_002805732.1 | Arc family DNA-binding protein | Antitoxin |
PD5205_RS09425 | 2004259..2004678 | + | 420 | WP_002805728.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PD5205_RS09430 | 2004835..2005449 | + | 615 | WP_040762517.1 | P-type conjugative transfer protein TrbJ | - |
PD5205_RS09435 | 2005535..2005777 | + | 243 | Protein_1833 | transposase | - |
PD5205_RS09440 | 2005895..2007262 | + | 1368 | WP_065975195.1 | IS5 family transposase | - |
PD5205_RS09445 | 2007285..2008190 | + | 906 | Protein_1835 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1989322..2006958 | 17636 | |
- | flank | IS/Tn | - | - | 1998182..1999519 | 1337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14879.07 Da Isoelectric Point: 5.1890
>T293570 WP_002805728.1 NZ_LT853885:2004259-2004678 [Xanthomonas fragariae]
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6H9H7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HLT7 |