Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 302040..302406 Replicon chromosome
Accession NZ_LT853885
Organism Xanthomonas fragariae strain PD5205

Toxin (Protein)


Gene name EcnB Uniprot ID A0A1Y6HEL5
Locus tag PD5205_RS01405 Protein ID WP_002809516.1
Coordinates 302040..302174 (-) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID A0A1Y6GQE1
Locus tag PD5205_RS01410 Protein ID WP_002809518.1
Coordinates 302254..302406 (-) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PD5205_RS01380 297173..298288 + 1116 WP_002809491.1 alpha/beta fold hydrolase -
PD5205_RS01385 298348..299257 - 910 Protein_262 EamA family transporter RarD -
PD5205_RS01390 299273..299878 - 606 Protein_263 drug/metabolite exporter YedA -
PD5205_RS01395 300039..300239 - 201 Protein_264 peptidase M20 -
PD5205_RS01400 300422..301711 - 1290 WP_002809514.1 tryptophan--tRNA ligase -
PD5205_RS01405 302040..302174 - 135 WP_002809516.1 entericidin A/B family lipoprotein Toxin
PD5205_RS01410 302254..302406 - 153 WP_002809518.1 entericidin A/B family lipoprotein Antitoxin
PD5205_RS01415 302515..303438 - 924 WP_002809521.1 arginase -
PD5205_RS01420 303796..304189 + 394 Protein_269 roadblock/LC7 domain-containing protein -
PD5205_RS01425 304212..304442 + 231 Protein_270 GTPase -
PD5205_RS01430 305984..305985 - 2 WP_088056924.1 IS5 family transposase -
PD5205_RS01435 306722..307068 + 347 Protein_272 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4425.27 Da        Isoelectric Point: 10.2040

>T293569 WP_002809516.1 NZ_LT853885:c302174-302040 [Xanthomonas fragariae]
MKRAIVLLVLSVLSVGILSGCNTVAGAGKDVKGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5241.20 Da        Isoelectric Point: 9.4952

>AT293569 WP_002809518.1 NZ_LT853885:c302406-302254 [Xanthomonas fragariae]
MKRLLTLMVLGLFSAGVMTGCNTFAGAGKDMQRAGSKVEKKADNCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Y6HEL5

Antitoxin

Source ID Structure
AlphaFold DB A0A1Y6GQE1

References