Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 23312..23862 | Replicon | plasmid pPD885-27 |
| Accession | NZ_LT853884 | ||
| Organism | Xanthomonas fragariae strain PD885 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A1Y6HCU7 |
| Locus tag | PD885_RS20195 | Protein ID | WP_002804295.1 |
| Coordinates | 23312..23596 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1Y6HDJ6 |
| Locus tag | PD885_RS20200 | Protein ID | WP_002804296.1 |
| Coordinates | 23584..23862 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PD885_RS20170 | 18918..19319 | - | 402 | WP_002804331.1 | hypothetical protein | - |
| PD885_RS21220 | 19371..19814 | + | 444 | WP_145954081.1 | hypothetical protein | - |
| PD885_RS21665 | 19821..19985 | + | 165 | WP_156775378.1 | hypothetical protein | - |
| PD885_RS20175 | 20173..20748 | + | 576 | WP_040762337.1 | recombinase family protein | - |
| PD885_RS20180 | 20759..21025 | + | 267 | WP_002804333.1 | hypothetical protein | - |
| PD885_RS20185 | 21160..22875 | + | 1716 | WP_083215115.1 | AAA family ATPase | - |
| PD885_RS20190 | 22944..23126 | + | 183 | WP_134656646.1 | hypothetical protein | - |
| PD885_RS20195 | 23312..23596 | - | 285 | WP_002804295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PD885_RS20200 | 23584..23862 | - | 279 | WP_002804296.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PD885_RS20210 | 24409..24834 | + | 426 | WP_172404533.1 | antitoxin VbhA family protein | - |
| PD885_RS20215 | 24876..25427 | + | 552 | WP_088057164.1 | recombinase family protein | - |
| PD885_RS20220 | 25530..26162 | + | 633 | WP_088057159.1 | ParA family protein | - |
| PD885_RS20225 | 26155..26517 | + | 363 | WP_088057160.1 | hypothetical protein | - |
| PD885_RS20230 | 26600..26923 | + | 324 | WP_088057161.1 | partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27106 | 27106 | |
| - | inside | IScluster/Tn | - | - | 20134..25427 | 5293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10801.49 Da Isoelectric Point: 10.0858
>T293568 WP_002804295.1 NZ_LT853884:c23596-23312 [Xanthomonas fragariae]
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HCU7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HDJ6 |