Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RHH |
| Location | 11747..12300 | Replicon | plasmid pPD885-27 |
| Accession | NZ_LT853884 | ||
| Organism | Xanthomonas fragariae strain PD885 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PD885_RS20100 | Protein ID | WP_088057157.1 |
| Coordinates | 11747..12040 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PD885_RS20105 | Protein ID | WP_088057158.1 |
| Coordinates | 12028..12300 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PD885_RS20075 | 7457..7819 | + | 363 | WP_088057153.1 | plasmid mobilization relaxosome protein MobC | - |
| PD885_RS20080 | 7809..10175 | + | 2367 | WP_108862514.1 | hypothetical protein | - |
| PD885_RS20085 | 10335..10553 | + | 219 | WP_088057162.1 | chromosome partitioning protein ParB | - |
| PD885_RS20090 | 10653..11012 | + | 360 | WP_088057155.1 | hypothetical protein | - |
| PD885_RS20095 | 11258..11671 | - | 414 | WP_088057156.1 | hypothetical protein | - |
| PD885_RS20100 | 11747..12040 | - | 294 | WP_088057157.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PD885_RS20105 | 12028..12300 | - | 273 | WP_088057158.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PD885_RS20110 | 12669..13067 | + | 399 | WP_108772809.1 | antitoxin VbhA family protein | - |
| PD885_RS20115 | 13109..13672 | + | 564 | WP_108772810.1 | recombinase family protein | - |
| PD885_RS20120 | 13715..13990 | + | 276 | Protein_18 | ParA family protein | - |
| PD885_RS20125 | 13992..14420 | - | 429 | WP_002804319.1 | DUF3757 domain-containing protein | - |
| PD885_RS21775 | 14622..14993 | - | 372 | WP_197685833.1 | hypothetical protein | - |
| PD885_RS21780 | 15026..15613 | + | 588 | WP_197685834.1 | hypothetical protein | - |
| PD885_RS21655 | 15944..16513 | - | 570 | WP_172404532.1 | hypothetical protein | - |
| PD885_RS20145 | 16628..16936 | - | 309 | WP_002804321.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27106 | 27106 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10753.29 Da Isoelectric Point: 6.4636
>T293567 WP_088057157.1 NZ_LT853884:c12040-11747 [Xanthomonas fragariae]
VPQVIVTEGAAQGLERCRRFLAAKAPEAAQRAGQAIERQFLLLEKSSDIGRPFPELPELRELVIAFGDSGYVALYRHEPA
ADAVYILAFRHQKEAGY
VPQVIVTEGAAQGLERCRRFLAAKAPEAAQRAGQAIERQFLLLEKSSDIGRPFPELPELRELVIAFGDSGYVALYRHEPA
ADAVYILAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|