Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 10001..10580 | Replicon | plasmid pPD885-29 |
Accession | NZ_LT853883 | ||
Organism | Xanthomonas fragariae strain PD885 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1Y6HD38 |
Locus tag | PD885_RS19910 | Protein ID | WP_002805372.1 |
Coordinates | 10001..10294 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1Y6HUN4 |
Locus tag | PD885_RS19915 | Protein ID | WP_002805369.1 |
Coordinates | 10281..10580 (-) | Length | 100 a.a. |
Genomic Context
Location: 5235..5786 (552 bp)
Type: Others
Protein ID: WP_065975505.1
Type: Others
Protein ID: WP_065975505.1
Location: 5773..6792 (1020 bp)
Type: Others
Protein ID: WP_052032118.1
Type: Others
Protein ID: WP_052032118.1
Location: 7450..8049 (600 bp)
Type: Others
Protein ID: WP_065975504.1
Type: Others
Protein ID: WP_065975504.1
Location: 9526..9750 (225 bp)
Type: Others
Protein ID: WP_002805375.1
Type: Others
Protein ID: WP_002805375.1
Location: 11059..11484 (426 bp)
Type: Others
Protein ID: WP_167699513.1
Type: Others
Protein ID: WP_167699513.1
Location: 11526..12101 (576 bp)
Type: Others
Protein ID: WP_065975506.1
Type: Others
Protein ID: WP_065975506.1
Location: 8553..9305 (753 bp)
Type: Others
Protein ID: WP_065975503.1
Type: Others
Protein ID: WP_065975503.1
Location: 9747..9923 (177 bp)
Type: Others
Protein ID: WP_156775376.1
Type: Others
Protein ID: WP_156775376.1
Location: 10001..10294 (294 bp)
Type: Toxin
Protein ID: WP_002805372.1
Type: Toxin
Protein ID: WP_002805372.1
Location: 10281..10580 (300 bp)
Type: Antitoxin
Protein ID: WP_002805369.1
Type: Antitoxin
Protein ID: WP_002805369.1
Location: 12262..12486 (225 bp)
Type: Others
Protein ID: WP_002805360.1
Type: Others
Protein ID: WP_002805360.1
Location: 12528..13151 (624 bp)
Type: Others
Protein ID: WP_002805358.1
Type: Others
Protein ID: WP_002805358.1
Location: 13148..14992 (1845 bp)
Type: Others
Protein ID: WP_065975501.1
Type: Others
Protein ID: WP_065975501.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PD885_RS19875 | 5235..5786 | + | 552 | WP_065975505.1 | plasmid mobilization relaxosome protein MobC | - |
PD885_RS19880 | 5773..6792 | + | 1020 | WP_052032118.1 | relaxase/mobilization nuclease domain-containing protein | - |
PD885_RS19890 | 7450..8049 | + | 600 | WP_065975504.1 | hypothetical protein | - |
PD885_RS19900 | 8553..9305 | - | 753 | WP_065975503.1 | hypothetical protein | - |
PD885_RS19905 | 9526..9750 | + | 225 | WP_002805375.1 | hypothetical protein | - |
PD885_RS21650 | 9747..9923 | - | 177 | WP_156775376.1 | hypothetical protein | - |
PD885_RS19910 | 10001..10294 | - | 294 | WP_002805372.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PD885_RS19915 | 10281..10580 | - | 300 | WP_002805369.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PD885_RS19925 | 11059..11484 | + | 426 | WP_167699513.1 | antitoxin VbhA family protein | - |
PD885_RS19930 | 11526..12101 | + | 576 | WP_065975506.1 | recombinase family protein | - |
PD885_RS19935 | 12262..12486 | - | 225 | WP_002805360.1 | DUF3717 domain-containing protein | - |
PD885_RS19940 | 12528..13151 | - | 624 | WP_002805358.1 | transglycosylase SLT domain-containing protein | - |
PD885_RS19945 | 13148..14992 | - | 1845 | WP_065975501.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..29233 | 29233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10915.49 Da Isoelectric Point: 5.1409
>T293566 WP_002805372.1 NZ_LT853883:c10294-10001 [Xanthomonas fragariae]
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
Download Length: 294 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HD38 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HUN4 |