Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2069121..2069791 | Replicon | chromosome |
| Accession | NZ_LT853882 | ||
| Organism | Xanthomonas fragariae strain PD885 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1Y6H9H7 |
| Locus tag | PD885_RS09660 | Protein ID | WP_002805728.1 |
| Coordinates | 2069372..2069791 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1Y6HLT7 |
| Locus tag | PD885_RS09655 | Protein ID | WP_002805732.1 |
| Coordinates | 2069121..2069375 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PD885_RS09630 | 2064706..2065710 | - | 1005 | WP_002805744.1 | hypothetical protein | - |
| PD885_RS09635 | 2065792..2066025 | + | 234 | WP_002805742.1 | hypothetical protein | - |
| PD885_RS09640 | 2066029..2066907 | + | 879 | WP_002805739.1 | helicase RepA family protein | - |
| PD885_RS09645 | 2066879..2067766 | + | 888 | WP_172404498.1 | replication protein C | - |
| PD885_RS09650 | 2068428..2068709 | + | 282 | WP_002805735.1 | TraK family protein | - |
| PD885_RS09655 | 2069121..2069375 | + | 255 | WP_002805732.1 | Arc family DNA-binding protein | Antitoxin |
| PD885_RS09660 | 2069372..2069791 | + | 420 | WP_002805728.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PD885_RS09665 | 2069948..2070562 | + | 615 | WP_040762517.1 | P-type conjugative transfer protein TrbJ | - |
| PD885_RS09670 | 2070648..2070890 | + | 243 | Protein_1836 | transposase | - |
| PD885_RS09675 | 2071008..2072375 | + | 1368 | WP_088056828.1 | IS5 family transposase | - |
| PD885_RS09680 | 2072398..2073303 | + | 906 | Protein_1838 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2036406..2072279 | 35873 | |
| - | flank | IS/Tn | - | - | 2063295..2064632 | 1337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14879.07 Da Isoelectric Point: 5.1890
>T293563 WP_002805728.1 NZ_LT853882:2069372-2069791 [Xanthomonas fragariae]
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6H9H7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HLT7 |