Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 17193..17752 | Replicon | plasmid pNBC2815-21 |
| Accession | NZ_LT853881 | ||
| Organism | Xanthomonas fragariae strain NBC2815 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NBC2815_RS19840 | Protein ID | WP_088062711.1 |
| Coordinates | 17193..17486 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1Y6HDJ6 |
| Locus tag | NBC2815_RS19845 | Protein ID | WP_002804296.1 |
| Coordinates | 17474..17752 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBC2815_RS19815 | 12787..13188 | - | 402 | WP_088062707.1 | hypothetical protein | - |
| NBC2815_RS20770 | 13240..13683 | + | 444 | WP_134656644.1 | hypothetical protein | - |
| NBC2815_RS21095 | 13690..13854 | + | 165 | WP_156775378.1 | hypothetical protein | - |
| NBC2815_RS19820 | 14042..14617 | + | 576 | WP_040762337.1 | recombinase family protein | - |
| NBC2815_RS19825 | 14628..14894 | + | 267 | WP_002804333.1 | hypothetical protein | - |
| NBC2815_RS19830 | 15040..16725 | + | 1686 | WP_088062709.1 | AAA family ATPase | - |
| NBC2815_RS19835 | 16834..17016 | + | 183 | WP_134656646.1 | hypothetical protein | - |
| NBC2815_RS19840 | 17193..17486 | - | 294 | WP_088062711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBC2815_RS19845 | 17474..17752 | - | 279 | WP_002804296.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| NBC2815_RS21200 | 18030..18578 | + | 549 | WP_002804297.1 | hypothetical protein | - |
| NBC2815_RS19855 | 18568..19215 | + | 648 | WP_002804298.1 | recombinase family protein | - |
| NBC2815_RS21100 | 19212..19349 | + | 138 | WP_167699514.1 | hypothetical protein | - |
| NBC2815_RS19860 | 19459..20091 | + | 633 | WP_002804299.1 | ParA family protein | - |
| NBC2815_RS19865 | 20084..20446 | + | 363 | WP_002804300.1 | hypothetical protein | - |
| NBC2815_RS19870 | 20529..20852 | + | 324 | WP_002804301.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..21045 | 21045 | |
| - | flank | IS/Tn | - | - | 14003..14617 | 614 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11102.84 Da Isoelectric Point: 10.0858
>T293562 WP_088062711.1 NZ_LT853881:c17486-17193 [Xanthomonas fragariae]
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEAGFP
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEAGFP
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|