Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2287012..2287682 | Replicon | chromosome |
Accession | NZ_LT853880 | ||
Organism | Xanthomonas fragariae strain NBC2815 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1Y6H9H7 |
Locus tag | NBC2815_RS10415 | Protein ID | WP_002805728.1 |
Coordinates | 2287012..2287431 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1Y6HLT7 |
Locus tag | NBC2815_RS10420 | Protein ID | WP_002805732.1 |
Coordinates | 2287428..2287682 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBC2815_RS20360 | 2282174..2283046 | + | 873 | WP_145953987.1 | hypothetical protein | - |
NBC2815_RS10400 | 2283417..2284784 | + | 1368 | WP_088062542.1 | IS5 family transposase | - |
NBC2815_RS10410 | 2286130..2286855 | - | 726 | WP_088062544.1 | P-type conjugative transfer protein TrbJ | - |
NBC2815_RS10415 | 2287012..2287431 | - | 420 | WP_002805728.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBC2815_RS10420 | 2287428..2287682 | - | 255 | WP_002805732.1 | Arc family DNA-binding protein | Antitoxin |
NBC2815_RS10425 | 2288094..2288375 | - | 282 | WP_002805735.1 | TraK family protein | - |
NBC2815_RS10430 | 2288993..2289566 | - | 574 | Protein_1995 | hypothetical protein | - |
NBC2815_RS10435 | 2289538..2290416 | - | 879 | WP_002805739.1 | helicase RepA family protein | - |
NBC2815_RS10440 | 2290420..2290653 | - | 234 | WP_002805742.1 | hypothetical protein | - |
NBC2815_RS10445 | 2290735..2291739 | + | 1005 | WP_002805744.1 | hypothetical protein | - |
NBC2815_RS10450 | 2291861..2292118 | + | 258 | WP_088061406.1 | AlpA family phage regulatory protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14879.07 Da Isoelectric Point: 5.1890
>T293560 WP_002805728.1 NZ_LT853880:c2287431-2287012 [Xanthomonas fragariae]
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6H9H7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HLT7 |