Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4127810..4128642 Replicon chromosome
Accession NZ_LT838200
Organism Escherichia coli isolate WI2 isolate

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag DSZ51_RS21285 Protein ID WP_000854765.1
Coordinates 4127810..4128184 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag DSZ51_RS21290 Protein ID WP_001295723.1
Coordinates 4128274..4128642 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DSZ51_RS21265 4123267..4126383 + 3117 WP_000149665.1 HsdR family type I site-specific deoxyribonuclease -
DSZ51_RS26920 4126871..4127029 - 159 WP_001467148.1 hypothetical protein -
DSZ51_RS21275 4127129..4127305 - 177 WP_000839290.1 DUF957 domain-containing protein -
DSZ51_RS21280 4127322..4127813 - 492 WP_000976842.1 hypothetical protein -
DSZ51_RS21285 4127810..4128184 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
DSZ51_RS21290 4128274..4128642 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
DSZ51_RS21295 4128805..4129026 - 222 WP_000692345.1 DUF987 domain-containing protein -
DSZ51_RS21300 4129089..4129565 - 477 WP_001186774.1 RadC family protein -
DSZ51_RS21305 4129581..4130054 - 474 WP_000855059.1 antirestriction protein -
DSZ51_RS21315 4130396..4130746 - 351 Protein_3919 DUF932 domain-containing protein -
DSZ51_RS21320 4130788..4132323 - 1536 WP_001333339.1 IS66-like element ISEc22 family transposase -
DSZ51_RS21325 4132372..4132719 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
DSZ51_RS21330 4132716..4133120 - 405 WP_000839179.1 IS66 family insertion sequence hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T293551 WP_000854765.1 NZ_LT838200:c4128184-4127810 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT293551 WP_001295723.1 NZ_LT838200:c4128642-4128274 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References