Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2472511..2473149 | Replicon | chromosome |
Accession | NZ_LT838200 | ||
Organism | Escherichia coli isolate WI2 isolate |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | DSZ51_RS12720 | Protein ID | WP_001447010.1 |
Coordinates | 2472973..2473149 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | DSZ51_RS12715 | Protein ID | WP_001270286.1 |
Coordinates | 2472511..2472927 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DSZ51_RS12695 | 2467663..2468604 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
DSZ51_RS12700 | 2468605..2469618 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
DSZ51_RS12705 | 2469636..2470781 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
DSZ51_RS12710 | 2471026..2472432 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
DSZ51_RS12715 | 2472511..2472927 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
DSZ51_RS12720 | 2472973..2473149 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
DSZ51_RS12725 | 2473371..2473601 | + | 231 | WP_000494244.1 | YncJ family protein | - |
DSZ51_RS12730 | 2473693..2475654 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
DSZ51_RS12735 | 2475727..2476263 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
DSZ51_RS12740 | 2476316..2477530 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T293546 WP_001447010.1 NZ_LT838200:c2473149-2472973 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT293546 WP_001270286.1 NZ_LT838200:c2472927-2472511 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|