Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1847921..1848744 Replicon chromosome
Accession NZ_LT838200
Organism Escherichia coli isolate WI2 isolate

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag DSZ51_RS09325 Protein ID WP_085543245.1
Coordinates 1847921..1848286 (-) Length 122 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag DSZ51_RS09330 Protein ID WP_001295723.1
Coordinates 1848376..1848744 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DSZ51_RS09285 1843298..1843480 - 183 WP_024167529.1 ethanolamine utilization protein -
DSZ51_RS26885 1843934..1844323 - 390 WP_001445118.1 IS110 family transposase -
DSZ51_RS09300 1845121..1845234 - 114 WP_001161660.1 DUF957 domain-containing protein -
DSZ51_RS09305 1845247..1845449 - 203 Protein_1720 hypothetical protein -
DSZ51_RS09310 1845551..1845955 + 405 WP_000839179.1 IS66 family insertion sequence hypothetical protein -
DSZ51_RS09315 1845952..1846299 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
DSZ51_RS09320 1846348..1847883 + 1536 WP_001333339.1 IS66-like element ISEc22 family transposase -
DSZ51_RS09325 1847921..1848286 - 366 WP_085543245.1 TA system toxin CbtA family protein Toxin
DSZ51_RS09330 1848376..1848744 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
DSZ51_RS09335 1848907..1849128 - 222 WP_000692345.1 DUF987 domain-containing protein -
DSZ51_RS09340 1849191..1849667 - 477 WP_001186774.1 RadC family protein -
DSZ51_RS09345 1849683..1850156 - 474 WP_000855059.1 antirestriction protein -
DSZ51_RS09355 1850498..1851316 - 819 WP_001234729.1 DUF945 domain-containing protein -
DSZ51_RS09365 1851471..1851629 - 159 WP_001323397.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1845348..1896771 51423


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 122 a.a.        Molecular weight: 13720.70 Da        Isoelectric Point: 6.9472

>T293539 WP_085543245.1 NZ_LT838200:c1848286-1847921 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHP

Download         Length: 366 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT293539 WP_001295723.1 NZ_LT838200:c1848744-1848376 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References