Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1847913..1848736 | Replicon | chromosome |
| Accession | NZ_LT838196 | ||
| Organism | Escherichia coli isolate WI1 isolate | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | WI2_RS09285 | Protein ID | WP_085543245.1 |
| Coordinates | 1847913..1848278 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | WI2_RS09290 | Protein ID | WP_001295723.1 |
| Coordinates | 1848368..1848736 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WI2_RS09255 | 1843290..1843472 | - | 183 | WP_024167529.1 | ethanolamine utilization protein | - |
| WI2_RS26850 | 1843926..1844315 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| WI2_RS26225 | 1845113..1845226 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| WI2_RS09265 | 1845239..1845441 | - | 203 | Protein_1720 | hypothetical protein | - |
| WI2_RS09270 | 1845543..1845947 | + | 405 | WP_000839179.1 | IS66 family insertion sequence hypothetical protein | - |
| WI2_RS09275 | 1845944..1846291 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| WI2_RS09280 | 1846340..1847875 | + | 1536 | WP_001333339.1 | IS66-like element ISEc22 family transposase | - |
| WI2_RS09285 | 1847913..1848278 | - | 366 | WP_085543245.1 | TA system toxin CbtA family protein | Toxin |
| WI2_RS09290 | 1848368..1848736 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| WI2_RS09300 | 1848899..1849120 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| WI2_RS09305 | 1849183..1849659 | - | 477 | WP_001186774.1 | RadC family protein | - |
| WI2_RS09310 | 1849675..1850148 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| WI2_RS09320 | 1850490..1851308 | - | 819 | WP_001234729.1 | DUF945 domain-containing protein | - |
| WI2_RS09330 | 1851463..1851621 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1845340..1896763 | 51423 | |
| - | inside | Genomic island | - | - | 1845340..1900320 | 54980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13720.70 Da Isoelectric Point: 6.9472
>T293514 WP_085543245.1 NZ_LT838196:c1848278-1847913 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHP
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHP
Download Length: 366 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT293514 WP_001295723.1 NZ_LT838196:c1848736-1848368 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|