Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 3753924..3754555 | Replicon | chromosome |
Accession | NZ_LT827011 | ||
Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety |
Toxin (Protein)
Gene name | hicA | Uniprot ID | L4J012 |
Locus tag | BQ9544_RS20120 | Protein ID | WP_001260301.1 |
Coordinates | 3754280..3754555 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | U9Y7E1 |
Locus tag | BQ9544_RS20115 | Protein ID | WP_000593555.1 |
Coordinates | 3753924..3754283 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9544_RS20090 | 3750056..3751000 | + | 945 | WP_000947070.1 | nickel ABC transporter permease subunit NikB | - |
BQ9544_RS20095 | 3750997..3751830 | + | 834 | WP_001008954.1 | nickel ABC transporter permease subunit NikC | - |
BQ9544_RS20100 | 3751830..3752594 | + | 765 | WP_001136232.1 | nickel import ATP-binding protein NikD | - |
BQ9544_RS20105 | 3752591..3753397 | + | 807 | WP_000173679.1 | nickel import ATP-binding protein NikE | - |
BQ9544_RS20110 | 3753403..3753804 | + | 402 | WP_001190063.1 | nickel-responsive transcriptional regulator NikR | - |
BQ9544_RS20115 | 3753924..3754283 | - | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BQ9544_RS20120 | 3754280..3754555 | - | 276 | WP_001260301.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BQ9544_RS20125 | 3754628..3755752 | - | 1125 | WP_001314210.1 | ABC transporter permease | - |
BQ9544_RS20130 | 3755752..3758487 | - | 2736 | WP_000149096.1 | ribosome-associated ATPase/putative transporter RbbA | - |
BQ9544_RS20135 | 3758484..3759551 | - | 1068 | WP_000361455.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10185.87 Da Isoelectric Point: 10.6128
>T293504 WP_001260301.1 NZ_LT827011:c3754555-3754280 [Escherichia coli O127:H6]
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT293504 WP_000593555.1 NZ_LT827011:c3754283-3753924 [Escherichia coli O127:H6]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4J012 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LKZ6 |