Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3205764..3206418 | Replicon | chromosome |
Accession | NZ_LT827011 | ||
Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | BQ9544_RS17175 | Protein ID | WP_000244781.1 |
Coordinates | 3205764..3206171 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | BQ9544_RS17180 | Protein ID | WP_000354046.1 |
Coordinates | 3206152..3206418 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9544_RS17155 | 3201721..3203454 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
BQ9544_RS17160 | 3203460..3204170 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
BQ9544_RS17165 | 3204195..3205091 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
BQ9544_RS17170 | 3205203..3205724 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
BQ9544_RS17175 | 3205764..3206171 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
BQ9544_RS17180 | 3206152..3206418 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
BQ9544_RS17185 | 3206661..3207641 | + | 981 | WP_000886076.1 | tRNA-modifying protein YgfZ | - |
BQ9544_RS17190 | 3207718..3208377 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
BQ9544_RS17195 | 3208541..3208852 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
BQ9544_RS17200 | 3208897..3210330 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T293503 WP_000244781.1 NZ_LT827011:c3206171-3205764 [Escherichia coli O127:H6]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|