Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1178509..1179304 Replicon chromosome
Accession NZ_LT827011
Organism Escherichia coli O127:H6 isolate EPEC E2348/69 variety

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag BQ9544_RS06195 Protein ID WP_000854914.1
Coordinates 1178930..1179304 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7UP42
Locus tag BQ9544_RS06190 Protein ID WP_001280955.1
Coordinates 1178509..1178883 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ9544_RS06150 1173864..1174769 + 906 WP_000203541.1 chemotaxis protein -
BQ9544_RS06155 1174766..1175836 + 1071 WP_000102671.1 patatin-like phospholipase family protein -
BQ9544_RS06170 1176176..1176994 + 819 WP_001234664.1 DUF945 domain-containing protein -
BQ9544_RS06175 1177085..1177570 + 486 WP_000214398.1 antirestriction protein -
BQ9544_RS06180 1177586..1178062 + 477 WP_001186738.1 RadC family protein -
BQ9544_RS06185 1178125..1178346 + 222 WP_001220314.1 DUF987 domain-containing protein -
BQ9544_RS06190 1178509..1178883 + 375 WP_001280955.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
BQ9544_RS06195 1178930..1179304 + 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
BQ9544_RS06200 1179301..1179792 + 492 WP_000976857.1 hypothetical protein -
BQ9544_RS06205 1179804..1180001 + 198 WP_000839282.1 DUF957 domain-containing protein -
BQ9544_RS06210 1180086..1180928 + 843 WP_001280481.1 DUF4942 domain-containing protein -
BQ9544_RS06220 1181398..1182336 + 939 WP_000351277.1 glyoxylate/hydroxypyruvate reductase GhrA -
BQ9544_RS06225 1182391..1183128 + 738 WP_000283657.1 zinc-binding phosphatase -
BQ9544_RS06230 1183152..1183706 + 555 WP_001001921.1 molecular chaperone YcdY -
BQ9544_RS06235 1183808..1184299 + 492 WP_001340063.1 DUF1097 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T293492 WP_000854914.1 NZ_LT827011:1178930-1179304 [Escherichia coli O127:H6]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13767.59 Da        Isoelectric Point: 6.6248

>AT293492 WP_001280955.1 NZ_LT827011:1178509-1178883 [Escherichia coli O127:H6]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9P0D0

References