Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 53264..53814 Replicon chromosome
Accession NZ_LT827011
Organism Escherichia coli O127:H6 isolate EPEC E2348/69 variety

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag BQ9544_RS00265 Protein ID WP_001160966.1
Coordinates 53500..53814 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag BQ9544_RS00260 Protein ID WP_000125566.1
Coordinates 53264..53497 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ9544_RS00235 48337..48624 + 288 WP_000203741.1 ferredoxin-like protein FixX -
BQ9544_RS00240 48683..50014 + 1332 WP_001183210.1 MFS transporter -
BQ9544_RS00245 50122..50652 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
BQ9544_RS00250 50645..52507 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
BQ9544_RS00255 52699..53178 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
BQ9544_RS00260 53264..53497 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
BQ9544_RS00265 53500..53814 + 315 WP_001160966.1 CcdB family protein Toxin
BQ9544_RS00270 53811..54659 - 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
BQ9544_RS00275 54666..55043 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
BQ9544_RS00280 55046..55867 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
BQ9544_RS00285 55864..56853 - 990 WP_000241226.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
BQ9544_RS00290 56853..58139 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T293489 WP_001160966.1 NZ_LT827011:53500-53814 [Escherichia coli O127:H6]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT293489 WP_000125566.1 NZ_LT827011:53264-53497 [Escherichia coli O127:H6]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References