293487

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 16559..17024 Replicon plasmid V
Accession NZ_LT795507
Organism Escherichia coli strain KV7 isolate KV7

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag KJB12_RS26415 Protein ID WP_001230707.1
Coordinates 16773..17024 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag KJB12_RS26410 Protein ID WP_000801440.1
Coordinates 16559..16786 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB12_RS26365 11884..12117 - 234 WP_134051832.1 EexN family lipoprotein -
KJB12_RS26370 12122..12388 - 267 WP_000160396.1 hypothetical protein -
KJB12_RS26375 12465..13694 - 1230 WP_001694183.1 DNA relaxase/nickase TaxC -
KJB12_RS26380 13706..14206 - 501 WP_063270188.1 DNA distortion polypeptide 1 -
KJB12_RS26385 14567..14914 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
KJB12_RS26390 14911..15159 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
KJB12_RS26395 15465..15770 - 306 WP_072182957.1 hypothetical protein -
KJB12_RS26400 15838..16110 - 273 WP_001272373.1 hypothetical protein -
KJB12_RS27050 16237..16557 - 321 WP_224693477.1 molecular chaperone DnaJ -
KJB12_RS26410 16559..16786 - 228 WP_000801440.1 hypothetical protein Antitoxin
KJB12_RS26415 16773..17024 - 252 WP_001230707.1 hypothetical protein Toxin
KJB12_RS26420 17021..17563 - 543 WP_001083906.1 hypothetical protein -
KJB12_RS26425 17668..18183 - 516 WP_001025395.1 J domain-containing protein -
KJB12_RS26430 19905..20750 + 846 WP_274535121.1 replication initiation protein -
KJB12_RS26435 20763..21167 + 405 WP_063270189.1 hypothetical protein -
KJB12_RS26440 21303..21830 + 528 WP_021526204.1 DUF2726 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..32709 32709


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T293487 WP_001230707.1 NZ_LT795507:c17024-16773 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT293487 WP_000801440.1 NZ_LT795507:c16786-16559 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References