293485

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 21635..22136 Replicon plasmid IV
Accession NZ_LT795506
Organism Escherichia coli strain KV7 isolate KV7

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag KJB12_RS26115 Protein ID WP_000702247.1
Coordinates 21635..21895 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag KJB12_RS26120 Protein ID WP_001132407.1
Coordinates 21885..22136 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB12_RS26070 16877..17038 + 162 WP_001128311.1 hypothetical protein -
KJB12_RS27025 17174..17326 + 153 Protein_25 DUF5431 family protein -
KJB12_RS26075 17271..17393 + 123 WP_223202818.1 Hok/Gef family protein -
KJB12_RS26080 17543..18139 + 597 WP_000125164.1 ProQ/FINO family protein -
KJB12_RS26085 18157..18441 - 285 WP_001162371.1 hypothetical protein -
KJB12_RS26090 18515..19180 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
KJB12_RS26095 19779..20108 + 330 WP_000855119.1 hypothetical protein -
KJB12_RS26100 20688..21011 + 324 WP_000427402.1 hypothetical protein -
KJB12_RS26105 21052..21261 + 210 WP_000866037.1 hypothetical protein -
KJB12_RS26110 21359..21583 + 225 WP_000814384.1 hypothetical protein -
KJB12_RS26115 21635..21895 + 261 WP_000702247.1 hypothetical protein Toxin
KJB12_RS26120 21885..22136 + 252 WP_001132407.1 transcriptional regulator Antitoxin
KJB12_RS26125 22686..22964 + 279 WP_000545938.1 hypothetical protein -
KJB12_RS27030 23352..23795 - 444 WP_000192626.1 hypothetical protein -
KJB12_RS26135 24092..24274 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
KJB12_RS26140 24299..24736 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
KJB12_RS26145 24867..25187 - 321 WP_000206710.1 hypothetical protein -
KJB12_RS26150 25198..25461 - 264 WP_000224227.1 hypothetical protein -
KJB12_RS27035 25796..25915 - 120 Protein_42 hypothetical protein -
KJB12_RS26160 25935..26534 - 600 WP_213222245.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..56568 56568


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T293485 WP_000702247.1 NZ_LT795506:21635-21895 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT293485 WP_001132407.1 NZ_LT795506:21885-22136 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References