Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3665842..3666460 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | KJB12_RS17510 | Protein ID | WP_001291435.1 |
Coordinates | 3666242..3666460 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | KJB12_RS17505 | Protein ID | WP_000344800.1 |
Coordinates | 3665842..3666216 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS17495 (3660931) | 3660931..3662124 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
KJB12_RS17500 (3662147) | 3662147..3665296 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
KJB12_RS17505 (3665842) | 3665842..3666216 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
KJB12_RS17510 (3666242) | 3666242..3666460 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
KJB12_RS17515 (3666632) | 3666632..3667183 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
KJB12_RS17520 (3667299) | 3667299..3667769 | + | 471 | WP_000136192.1 | YlaC family protein | - |
KJB12_RS17525 (3667933) | 3667933..3669483 | + | 1551 | WP_213222217.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
KJB12_RS17530 (3669525) | 3669525..3669878 | - | 354 | WP_000878146.1 | DUF1428 family protein | - |
KJB12_RS17540 (3670257) | 3670257..3670568 | + | 312 | WP_000409914.1 | MGMT family protein | - |
KJB12_RS17545 (3670599) | 3670599..3671171 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T293473 WP_001291435.1 NZ_LT795502:3666242-3666460 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT293473 WP_000344800.1 NZ_LT795502:3665842-3666216 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |