Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2521154..2521792 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A080J2T0 |
Locus tag | KJB12_RS12150 | Protein ID | WP_000813793.1 |
Coordinates | 2521616..2521792 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | KJB12_RS12145 | Protein ID | WP_001270286.1 |
Coordinates | 2521154..2521570 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS12125 (2516306) | 2516306..2517247 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
KJB12_RS12130 (2517248) | 2517248..2518261 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
KJB12_RS12135 (2518279) | 2518279..2519424 | - | 1146 | WP_000047419.1 | ABC transporter substrate-binding protein | - |
KJB12_RS12140 (2519669) | 2519669..2521075 | - | 1407 | WP_000760655.1 | PLP-dependent aminotransferase family protein | - |
KJB12_RS12145 (2521154) | 2521154..2521570 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
KJB12_RS12150 (2521616) | 2521616..2521792 | - | 177 | WP_000813793.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
KJB12_RS12155 (2522014) | 2522014..2522244 | + | 231 | WP_000494244.1 | YncJ family protein | - |
KJB12_RS12160 (2522336) | 2522336..2524297 | - | 1962 | WP_024257894.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
KJB12_RS12165 (2524370) | 2524370..2524906 | - | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
KJB12_RS12170 (2524959) | 2524959..2526170 | + | 1212 | WP_023154256.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.83 Da Isoelectric Point: 10.9223
>T293472 WP_000813793.1 NZ_LT795502:c2521792-2521616 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT293472 WP_001270286.1 NZ_LT795502:c2521570-2521154 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|