Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1345154..1345779 | Replicon | chromosome |
| Accession | NZ_LT795502 | ||
| Organism | Escherichia coli strain KV7 isolate KV7 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | KJB12_RS06410 | Protein ID | WP_000911329.1 |
| Coordinates | 1345381..1345779 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | KJB12_RS06405 | Protein ID | WP_000450524.1 |
| Coordinates | 1345154..1345381 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJB12_RS06380 (1340956) | 1340956..1341426 | - | 471 | WP_001068690.1 | thioredoxin-dependent thiol peroxidase | - |
| KJB12_RS06385 (1341426) | 1341426..1341998 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| KJB12_RS06390 (1342144) | 1342144..1343022 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| KJB12_RS06395 (1343039) | 1343039..1344073 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| KJB12_RS06400 (1344286) | 1344286..1344999 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| KJB12_RS06405 (1345154) | 1345154..1345381 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| KJB12_RS06410 (1345381) | 1345381..1345779 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| KJB12_RS06415 (1345926) | 1345926..1346789 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| KJB12_RS06420 (1346804) | 1346804..1348819 | + | 2016 | WP_000829353.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| KJB12_RS06425 (1348893) | 1348893..1349591 | + | 699 | WP_000679812.1 | esterase | - |
| KJB12_RS06430 (1349672) | 1349672..1349872 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T293464 WP_000911329.1 NZ_LT795502:1345381-1345779 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |