Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1048399..1048982 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9Y5H3 |
Locus tag | KJB12_RS04980 | Protein ID | WP_000254735.1 |
Coordinates | 1048647..1048982 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U9Y5F1 |
Locus tag | KJB12_RS04975 | Protein ID | WP_000581936.1 |
Coordinates | 1048399..1048647 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS04965 (1044738) | 1044738..1046039 | + | 1302 | WP_000046797.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
KJB12_RS04970 (1046087) | 1046087..1048321 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
KJB12_RS04975 (1048399) | 1048399..1048647 | + | 249 | WP_000581936.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
KJB12_RS04980 (1048647) | 1048647..1048982 | + | 336 | WP_000254735.1 | endoribonuclease MazF | Toxin |
KJB12_RS04985 (1049054) | 1049054..1049845 | + | 792 | WP_001071673.1 | nucleoside triphosphate pyrophosphohydrolase | - |
KJB12_RS04990 (1050073) | 1050073..1051710 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
KJB12_RS04995 (1051798) | 1051798..1053096 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12070.03 Da Isoelectric Point: 8.2605
>T293463 WP_000254735.1 NZ_LT795502:1048647-1048982 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|