Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 902736..903390 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | KJB12_RS04330 | Protein ID | WP_000244777.1 |
Coordinates | 902983..903390 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | KJB12_RS04325 | Protein ID | WP_000354046.1 |
Coordinates | 902736..903002 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS04305 (898866) | 898866..899177 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
KJB12_RS04310 (899341) | 899341..900000 | + | 660 | WP_000250270.1 | hemolysin III family protein | - |
KJB12_RS04315 (900087) | 900087..901435 | + | 1349 | WP_100245061.1 | IS3-like element IS1397 family transposase | - |
KJB12_RS04320 (901513) | 901513..902493 | - | 981 | WP_000886100.1 | tRNA-modifying protein YgfZ | - |
KJB12_RS04325 (902736) | 902736..903002 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
KJB12_RS04330 (902983) | 902983..903390 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
KJB12_RS04335 (903430) | 903430..903951 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
KJB12_RS04340 (904063) | 904063..904959 | + | 897 | WP_000806630.1 | site-specific tyrosine recombinase XerD | - |
KJB12_RS04345 (904984) | 904984..905694 | + | 711 | WP_000715218.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
KJB12_RS04350 (905700) | 905700..907433 | + | 1734 | WP_000813236.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T293462 WP_000244777.1 NZ_LT795502:902983-903390 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |