Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 327359..328159 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | U9Y257 |
Locus tag | KJB12_RS01505 | Protein ID | WP_000342447.1 |
Coordinates | 327632..328159 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | U9Y285 |
Locus tag | KJB12_RS01500 | Protein ID | WP_001277109.1 |
Coordinates | 327359..327625 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS01480 (323017) | 323017..323685 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
KJB12_RS01485 (323678) | 323678..324736 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
KJB12_RS01490 (324981) | 324981..325835 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
KJB12_RS01495 (326106) | 326106..327209 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
KJB12_RS01500 (327359) | 327359..327625 | + | 267 | WP_001277109.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
KJB12_RS01505 (327632) | 327632..328159 | + | 528 | WP_000342447.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
KJB12_RS01510 (328156) | 328156..328539 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
KJB12_RS01515 (328963) | 328963..330072 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
KJB12_RS01520 (330120) | 330120..331046 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
KJB12_RS01525 (331043) | 331043..332320 | + | 1278 | WP_000803778.1 | branched chain amino acid ABC transporter permease LivM | - |
KJB12_RS01530 (332317) | 332317..333084 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.63 Da Isoelectric Point: 7.0284
>T293459 WP_000342447.1 NZ_LT795502:327632-328159 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUN0 |