Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1640281..1640747 Replicon chromosome
Accession NZ_LT706985
Organism Propionimicrobium sp. Marseille-P3275 strain Marseille-P3275T

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag CZ356_RS07750 Protein ID WP_076389395.1
Coordinates 1640281..1640529 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag CZ356_RS07755 Protein ID WP_076389396.1
Coordinates 1640526..1640747 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CZ356_RS09650 1635553..1636107 - 555 WP_156874614.1 hypothetical protein -
CZ356_RS07715 1636726..1636950 + 225 WP_076389388.1 hypothetical protein -
CZ356_RS07720 1636947..1637327 + 381 WP_076389389.1 hypothetical protein -
CZ356_RS07725 1637330..1637776 + 447 WP_076389390.1 hypothetical protein -
CZ356_RS09655 1637751..1637975 + 225 WP_162272880.1 hypothetical protein -
CZ356_RS07730 1637978..1638172 + 195 WP_076389391.1 hypothetical protein -
CZ356_RS07735 1638731..1639015 - 285 WP_076389392.1 hypothetical protein -
CZ356_RS07740 1639197..1639481 + 285 WP_076389393.1 hypothetical protein -
CZ356_RS07745 1639620..1639922 + 303 WP_076389394.1 hypothetical protein -
CZ356_RS07750 1640281..1640529 - 249 WP_076389395.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CZ356_RS07755 1640526..1640747 - 222 WP_076389396.1 antitoxin Antitoxin
CZ356_RS07760 1640915..1641118 + 204 WP_076389397.1 ribbon-helix-helix domain-containing protein -
CZ356_RS07765 1641106..1641603 + 498 WP_076389398.1 Fic family protein -
CZ356_RS07770 1641563..1641787 + 225 WP_076389399.1 helix-turn-helix domain-containing protein -
CZ356_RS07775 1641963..1642148 + 186 WP_076389400.1 hypothetical protein -
CZ356_RS09660 1642278..1642418 - 141 WP_156874616.1 hypothetical protein -
CZ356_RS07780 1642743..1643222 + 480 WP_076389401.1 hypothetical protein -
CZ356_RS09665 1643353..1643505 - 153 WP_156874617.1 hypothetical protein -
CZ356_RS07785 1643835..1644050 - 216 WP_156874618.1 hypothetical protein -
CZ356_RS07790 1644142..1644447 - 306 WP_076389403.1 hypothetical protein -
CZ356_RS09670 1644758..1645003 - 246 WP_156874619.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-82)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9670.13 Da        Isoelectric Point: 10.9556

>T293453 WP_076389395.1 NZ_LT706985:c1640529-1640281 [Propionimicrobium sp. Marseille-P3275]
VSWSVESTRRFEREFKKLDKFTQRLIKGRIEKNLSNTQNPRQHGRALSANLASLWRYRVGDYRIICEIVDERLVILALSV
GH

Download         Length: 249 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8414.50 Da        Isoelectric Point: 5.6032

>AT293453 WP_076389396.1 NZ_LT706985:c1640747-1640526 [Propionimicrobium sp. Marseille-P3275]
MAFSIRLTDQEKSLATSYAKLHHISLGEAFKRALFERIEDEHDLAVGKQAKEEYVQQGRVSRPIDQLWDELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References