Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-DinJ |
Location | 1468345..1468897 | Replicon | chromosome |
Accession | NZ_LT706985 | ||
Organism | Propionimicrobium sp. Marseille-P3275 strain Marseille-P3275T |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CZ356_RS07005 | Protein ID | WP_076389272.1 |
Coordinates | 1468571..1468897 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | CZ356_RS07000 | Protein ID | WP_076389271.1 |
Coordinates | 1468345..1468581 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CZ356_RS06970 | 1463689..1464345 | - | 657 | WP_076389268.1 | alpha/beta fold hydrolase | - |
CZ356_RS06975 | 1464342..1464935 | - | 594 | WP_076389269.1 | DUF1700 domain-containing protein | - |
CZ356_RS06980 | 1464938..1465270 | - | 333 | WP_076389916.1 | PadR family transcriptional regulator | - |
CZ356_RS06985 | 1465417..1466043 | - | 627 | WP_197684241.1 | recombinase zinc beta ribbon domain-containing protein | - |
CZ356_RS09640 | 1466151..1466315 | - | 165 | WP_156874602.1 | hypothetical protein | - |
CZ356_RS06990 | 1466543..1467979 | + | 1437 | WP_076389270.1 | putative DNA binding domain-containing protein | - |
CZ356_RS06995 | 1468051..1468200 | + | 150 | Protein_1351 | toxin-antitoxin system subunit antitoxin | - |
CZ356_RS07000 | 1468345..1468581 | + | 237 | WP_076389271.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
CZ356_RS07005 | 1468571..1468897 | + | 327 | WP_076389272.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CZ356_RS07010 | 1469275..1470492 | - | 1218 | WP_076389273.1 | DUF4143 domain-containing protein | - |
CZ356_RS07015 | 1470901..1472181 | + | 1281 | WP_076389274.1 | DUF4143 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11206.96 Da Isoelectric Point: 8.7596
>T293452 WP_076389272.1 NZ_LT706985:1468571-1468897 [Propionimicrobium sp. Marseille-P3275]
MRGEIWTVCASGYASKPRPAVIVQADSVVGFDSTIVCLFTTDDSLKGATRVSVKATGGNGLTKDCIVMAEKPVAINKSRL
GEKLGALEAETLSKVGSALRQVFGFGVG
MRGEIWTVCASGYASKPRPAVIVQADSVVGFDSTIVCLFTTDDSLKGATRVSVKATGGNGLTKDCIVMAEKPVAINKSRL
GEKLGALEAETLSKVGSALRQVFGFGVG
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|